SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006323 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006323
Domain Number 1 Region: 1203-1269
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-20
Family TB module/8-cys domain 0.00000887
Further Details:      
 
Domain Number 2 Region: 531-597
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.24e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1377-1438
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-17
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 4 Region: 982-1110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 410-480
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000129
Family TB module/8-cys domain 0.0033
Further Details:      
 
Domain Number 6 Region: 864-983
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 778-898
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 731-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 9 Region: 476-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1101-1156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000124
Family EGF-type module 0.017
Further Details:      
 
Domain Number 11 Region: 1481-1566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 12 Region: 1321-1366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000661
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 13 Region: 1281-1330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000295
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 261-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000703
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006323
Domain Number - Region: 49-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000194
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1148-1174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0122
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006323   Gene: ENSCPOG00000007011   Transcript: ENSCPOT00000007080
Sequence length 1580
Comment pep:known scaffold:cavPor3:scaffold_18:14393391:14797475:1 gene:ENSCPOG00000007011 transcript:ENSCPOT00000007080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPQETQSGAASRLQFHPKQQLQGVNICGGQCCHGWSKAPGSQRCTKPSCVPPCQNGGMC
LRPQLCVCKPGTKGKACETTVAQDTLSTAFGGNPGAAPSWGPSEQAAKHTSSKKAETLPR
VSPVAQMTLTLKPKPAVGLSQQIRSQVTPLSSQNVVIHHAQAQEYVLRPKYFPAQKVISG
EQSTEGSFPLRYGQDHVAAPFQLSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTL
ISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASLPKL
YQHSQQPGKALGTHLIHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSR
IDGPSGQKVKDAQPGQTQVSYQGLPMQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQE
TIGSQCGKALPGLSKKEDCCGTVGTSWGFNKCQKCPKKPAYHGYNQMMECLQGYKRVNNT
FCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVIAEEKGPCYRL
VSSSRQCLHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHR
RRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSQEHGPGAAESEVATA
PPEKEIPSLDQEKIKLEPGQPQLSPGISTFNLHPQFPGIVIEKTSPPGPVEVAPEASTSS
ASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQQRKCVDIDECTQ
AQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGDGHCVNTMGAFRC
EYCDSGYRMTRRGRCEDIDECLTPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDIDE
CLEPNVCANGSCSNLEGSYMCSCHKGYSPTPDHRHCQDIDECQQGNLCINGQCKNTEGSF
RCTCGQGYQLSAAKDQCEDIDECQHHHLCTHGQCRNTEGSFQCVCDHGYRASALGDHCED
INECLEDKSACQGGDCINTDGSYDCTCPDGFQLNDHKGCEDINECEQPGLCGPHGECLNT
DGSFHCVCEQGFSISADGRTCEDIDECVNNTVCDRHGFCDNTAGSFRCLCYQGFQAPQDG
QGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRSSRGLVLDAGP
PKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMC
PRGKGFVPTGGSSYDIGGENYKDADECLLFGQEICKNGFCLNTQPGYECYCKQGTYYDPV
KLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIQPTESNEQIEETDV
YQDLCWEHLSEEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPV
TGRRRPYGRDALVDFSEQYSPEADPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQE
GYTCDCFDGYHLDMARMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDK
PNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences ENSCPOP00000006323 10141.ENSCPOP00000006323 ENSCPOP00000006323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]