SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006380 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006380
Domain Number 1 Region: 431-687
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1345-1602
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-57
Family YWTD domain 0.00000335
Further Details:      
 
Domain Number 3 Region: 733-989
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 4 Region: 1040-1293
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-49
Family YWTD domain 0.00000375
Further Details:      
 
Domain Number 5 Region: 254-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 218-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000013
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 7 Region: 299-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 56-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 133-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 10 Region: 1299-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000512
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 11 Region: 348-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000494
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 98-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 177-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 689-726,984-1035
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 378-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000519
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 16 Region: 16-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006380
Domain Number - Region: 1602-1639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000301
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006380   Gene: ENSCPOG00000007072   Transcript: ENSCPOT00000007142
Sequence length 1895
Comment pep:known scaffold:cavPor3:scaffold_72:6271016:6303495:-1 gene:ENSCPOG00000007072 transcript:ENSCPOT00000007142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPFPCPGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDLSDEDGCMLPT
CSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWHCD
GDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPAPP
CNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGWRC
DGDPDCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSP
QCASDQFLCRNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQ
TVRGAVQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPDR
RSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLD
RILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLW
QNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGR
RMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFT
GKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRK
ISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWT
DVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMR
TVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAI
DYGSQRLYWADAGMKTIEFAGLDGSSRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQS
ADRLTGLGRKTLQENLENLMDIHVFHRRRPPVTTPCAAENGGCSHLCLRSPNPSGFSCTC
PTGINLLPDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINITMKNTIAIGVDP
QEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLTVDAIGRKVYWTDTGTNRIEV
GNLDGSMRKVLVWQNLDSPRAIVLYHEMGLMYWTDWGENAKLERAAMDGSERTVLINNNL
GWPNGLTVDKVSSQLLWADAHTERIEAADLSGGNRHTLVSPVQHPYGLTLLDSYIYWTDW
QTRSIHRADKGTGSNVILVRSNLPGLMDIQAVDRAQPLGLNKCGSGNGGCSHLCLPRPSG
FSCACPTGIQLKADGRTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVISL
DYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGQGLKTTDGLAVDWVARNLYWTDTGRN
TIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLI
NTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDRWIY
WTDWQTKSIQRVDKYSGRSKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFA
RASDFVCACPDEPDSRPCSLVPGLVPPAPRATSMSENSPVLPNTLPPTFHSSTSRTHTAL
EEVEGRCSERDARLGRCAHSNEAVPAAPGEGLHISYAIGGLLSVLLVLVVIAALMLYRHK
KSKFTDPGMGNLTYSNPSYRTSTQEVKIEAVPKPAMYNQLCYKKEGGPDHNYTKEKIKIV
EGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQ
SECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
Download sequence
Identical sequences ENSCPOP00000006380 10141.ENSCPOP00000006380 ENSCPOP00000006380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]