SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006390 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006390
Domain Number 1 Region: 977-1153
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.26e-56
Family Crystallins/Ca-binding development proteins 0.0000467
Further Details:      
 
Domain Number 2 Region: 794-964
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.42e-46
Family Crystallins/Ca-binding development proteins 0.00055
Further Details:      
 
Domain Number 3 Region: 1166-1334
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.36e-42
Family Crystallins/Ca-binding development proteins 0.00073
Further Details:      
 
Domain Number 4 Region: 1340-1469
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.68e-18
Family Ricin B-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006390   Gene: ENSCPOG00000007086   Transcript: ENSCPOT00000007156
Sequence length 1471
Comment pep:known scaffold:cavPor3:scaffold_25:9802912:9819001:1 gene:ENSCPOG00000007086 transcript:ENSCPOT00000007156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAAGPPARAEARVVSATLTWRQRPPAQEEIRHHFHKVSLVSGAREEMFGYTYAQEEVN
GFATREEETVNHQGLRDEAGSANFQSHGPIFSKKYMPPPKEKKLVGRPKWTSDQTDSIPQ
APRTEPPGLGAAARTELLVPLPGPRDPSPHPGGNHTGGSTWNREECRVTRTVRTTTVVGG
HVDHRMSSSVTVGPMLSSETLPRGRHVVRSVRAAVVNPQAEDSPSRSKARELLGSLVAAE
SSSPASRLPRPTNVVPRSPGLGGTEGTVLEQLPETGTAQPKVPAGSPVGPHPPQNHEVPT
TCPDQDQGRALDIKACEPLRVQGASSPTPLSPQTSRGQTPVPSSPRLQTRASSPGLAQRS
EQPVLAYGLPSVEGERLSDPPAVPTPPVERTEAATVPGQPLIPPSITKKPVPSPGGLSAA
SSRRSKFVQDSENVPLSSLTQKEVLHVPGAPSASSPKPTKVTQGPEGDPSTQKEVAKSIP
TPSLPKEETVQGPAAPVPLLLKEEEASPGARGSPVSSSTQKEDIQSPAVSSTPSSVGKET
PSPGGTPVSVPVETEASTESQLVPDSVEDKSLPESSNEEDEMALAADLEIFLDTLRSMEP
PEILRTHRLPRAPRSSYLAMYATLPAIDEDHPGPWVLGPSPQVVPTPYLSDDEKLQRRQE
KAGPSPSWGSRPARPTQDSCSPLEMMKKHVADAKSSHPELGLELQTGTRPTSRLGSSILF
SNLVPATKEAPSLEPLGAKLSALPPHPAPGLRKVPGQLPLLCSGRPPPEKLTCAQPLEGW
SPSLKKQGKLNTRPGKVIFFSEPGCQGSSREVYEDIADASGWDLVASIRVVRGCWVLYEQ
PEFQGQKLVLPEGDVELRGLRPAWSTHGIGSLRRVVRDYCTPEIILFSEEGLKGEQVKLT
EALKDPEGLERPLQVASATVSAGLWMLYPKPFFEDTPYILEPGEYPTLEAWGTSNPTVGS
LKPMTLGCPSVEKPAEPKAVVYEAPDFQGKSWEVSRDIYNLQQPEDSQSPDLASVGSLRV
LGGCWVGYEKAGFRGHQYLLEEGEYADWSHWGGYDELLTSLRIIRTDFGDPAVVLFEAMD
FQGHGVEVSTALPDVELMQHGPHTQAIHVLSGVWVAYEQVGFSGEQYVLEKGVYRNCDDW
GAGNSALASLQPVLQVGEHDLHFVSKIQLFSGPDFLGEHLCFEDDQACLPPSFQPQSCRV
LGGSWILFDGKNFEGDQHILSEGEFPTLMAMGCLASTVLGSLRKVPLHFSEPAIFLYGLE
CFEGKEIELSGEVRSLQAQGFNNHVLSVRNAGPSWVLCEHSDFRGHQWLVSSCEITNWLT
YSGTQRVGSLYPIKQQRRAYFCLWNAALGGFLAVPDHVEDMKAGRVVVSRPQAGGSYIWY
YEDGLLKNQVAPTMSLQVIGPPSPGSKVVLWAESRLPRQTWSIDELGHICSQMFQGQILD
VKGGRGYDRDHVVLWELAEDRASQIWTIHVL
Download sequence
Identical sequences 10141.ENSCPOP00000006390 ENSCPOP00000006390 ENSCPOP00000006390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]