SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006471 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006471
Domain Number 1 Region: 141-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 59-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000282
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006471   Gene: ENSCPOG00000007175   Transcript: ENSCPOT00000007246
Sequence length 278
Comment pep:known scaffold:cavPor3:scaffold_18:39177930:39180929:1 gene:ENSCPOG00000007175 transcript:ENSCPOT00000007246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAMWGSPQLLLLWLLVLAAGGTGHAYRPSRRVCAAAGAAPGSISESFVQRVYQPFLTTC
DGHRACSTYRTIYRTAYRRGPGLGPTRPRFACCPGWKRTGGLPGACATAVCQPPCGNGGS
CVWPGRCHCPAGWRGNTCHTDVDECSSGGADCPQACVNTAGSYRCQCWEGHSPSADGTHC
LPTAGPPQVAPNAMTGVDPTARAEVQRLQTRVEALEQKLQLVLAPLHGLASRAPEYGPQD
PGSLLAHSLQQLDRIDSLSEQISFLEEQLGSCECPRHL
Download sequence
Identical sequences 10141.ENSCPOP00000006471 ENSCPOP00000006471 ENSCPOP00000006471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]