SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006485 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006485
Domain Number 1 Region: 283-565
Classification Level Classification E-value
Superfamily Kelch motif 6.93e-47
Family Kelch motif 0.0046
Further Details:      
 
Domain Number 2 Region: 704-850
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-23
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 3 Region: 49-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-22
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 4 Region: 984-1030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000285
Family Laminin-type module 0.007
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006485
Domain Number - Region: 20-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 170-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00544
Family EGF-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006485   Gene: ENSCPOG00000007193   Transcript: ENSCPOT00000007265
Sequence length 1350
Comment pep:novel scaffold:cavPor3:scaffold_8:21027717:21171181:-1 gene:ENSCPOG00000007193 transcript:ENSCPOT00000007265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAGAGGRAASVSGSAASEAKECDRPCVNGGRCNPGTGLCVCPTGWVGEQCQHCGGRFRLT
GSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAPLI
AAFSGLIVPERDSNETVPEVVVTSGYALLHFFSDAAYNLTGFNITYNFDMCPNNCSGRGV
CKISNSSNTVECECSENWTGESCDIPYCTDNCGFPHRGICNSSNVRGCSCLSEWQGPGCS
VPVPANQSFWTREEYSNLKLPRASHKAVVNGNTMWIVGGYMFNHSDYNMVLAYDLVSKEW
LPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHIHNESWVLLTPKAK
EQYAVVGHSAHIVTLNTGRVVMLVIFGHCPLYGYISNVQEYDLDKNTWSILPTQGALVQG
GYGHSSVYDHKTKALYVHGGYKAFSANKYRLTDDLYRYDVDTQMWTILKDSRFFRYLHTA
VVVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHHDVNRFGHSA
VLHNSTMYVFGGFNSLLLSDILVFTSEQCESHQSEAACIAAGPGIRCVWDTETSQCVSWE
LTTEEQVIKLKSECVSKGTLDHDRCDQNTDCYSCTANTNDCHWCNDHCVPRNHSCTEGQI
SIFKYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGMGWHLVGNVC
LKITTAKENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRMMQSSQTMSKLTLTPWVGL
RKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSNRGLKAATCINPLNGSVCE
RPANHSAKQCRTPCALRTACGECTSSSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTM
SSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQASTGIVYPQ
PLLNSSMCLEDGRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGYYGD
PTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLKGTCYYTL
LIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFSAGTQA
GEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPVKIQIAFSQHSNFMDL
VQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVNVALETDE
EPPDLIGGSVKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDI
SQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSCPOP00000006485 ENSCPOP00000006485 10141.ENSCPOP00000006485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]