SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006731 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006731
Domain Number 1 Region: 258-375
Classification Level Classification E-value
Superfamily C-type lectin-like 5.5e-33
Family C-type lectin domain 0.00000605
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000000000163
Family Triple coiled coil domain of C-type lectins 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006731   Gene: ENSCPOG00000007463   Transcript: ENSCPOT00000007535
Sequence length 375
Comment pep:known scaffold:cavPor3:scaffold_62:10630055:10642264:-1 gene:ENSCPOG00000007463 transcript:ENSCPOT00000007535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLSLLYLLTQPQGNLGAVMKSYQPRTLANACTLVICSPAENGLPGRDGRDGREGPR
GEKGEPGVPGATGPAGMPGIAGPVGPKGDNGSAGEPGPKGDVGPSGPPGLPGAPGPVGKD
GPPGKQGNIGPQGKPGLKGEAGPKGEVGAPGMQGSTGARGPMGAKGEKGAPGELGAPGSA
GAAGSAGAVGPQGPVGARGPPGLKGDRGAPGDKGAKGESGLPDITALKQQVEDLRGQLQS
LQAAFSRYKKAELFPNGQSVGDKIFKTVGSEKTFEGAQEMCSKAGGQVASPRSAAENAAL
QELITAQNKAAFLGMTDSKKEGTFVYPSGEPLVYSNWVSGEPNNAGGVENCVEMFTNGKW
NDKNCGEQRLVVCEF
Download sequence
Identical sequences XP_003466140.1.53824 10141.ENSCPOP00000006731 ENSCPOP00000006731 ENSCPOP00000006731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]