SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006867 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006867
Domain Number 1 Region: 97-264
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-34
Family C-type lectin domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006867   Gene: ENSCPOG00000007621   Transcript: ENSCPOT00000007694
Sequence length 273
Comment pep:known scaffold:cavPor3:scaffold_28:4506962:4528194:1 gene:ENSCPOG00000007621 transcript:ENSCPOT00000007694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTKYSSERDVRDMLDDDEDTTMSLHSRASTLTWRPEPRHTELRTPLSTWRPVALTLLTL
CLVLLVGLAALGLVFFQFYQLSNIQQAIITEKEERLGNLSQQLQSLQVKNKKLVDTLQRV
AEKLCRELYNKSGGPRCSPCPEKWKWHGDKCYQFYRESKSWQGCEYFCSAENSTMLKINA
QEVLDFSMLQSYSEFFYSYWTGLSRNGSGEAWLWMDGTPYSFQLFEIIIDASNLRSRDCV
TILNGKAFSKDCRELRRCACERTAGRVDPEKLH
Download sequence
Identical sequences A0A286Y1W9
10141.ENSCPOP00000006867 ENSCPOP00000006867 XP_003470390.1.53824 ENSCPOP00000006867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]