SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006876 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006876
Domain Number 1 Region: 3326-3541
Classification Level Classification E-value
Superfamily GFP-like 5.86e-64
Family Domain G2 of nidogen-1 0.00073
Further Details:      
 
Domain Number 2 Region: 932-1031
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-25
Family I set domains 0.0091
Further Details:      
 
Domain Number 3 Region: 1417-1516
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-24
Family I set domains 0.0069
Further Details:      
 
Domain Number 4 Region: 2074-2174
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-23
Family I set domains 0.0094
Further Details:      
 
Domain Number 5 Region: 2530-2627
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-23
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 851-939
Classification Level Classification E-value
Superfamily Immunoglobulin 3.2e-23
Family I set domains 0.0097
Further Details:      
 
Domain Number 7 Region: 1040-1127
Classification Level Classification E-value
Superfamily Immunoglobulin 3.85e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 8 Region: 1510-1611
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-23
Family I set domains 0.0094
Further Details:      
 
Domain Number 9 Region: 1138-1226
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 2348-2446
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-23
Family I set domains 0.018
Further Details:      
 
Domain Number 11 Region: 2803-2902
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 12 Region: 1337-1425
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-22
Family I set domains 0.0069
Further Details:      
 
Domain Number 13 Region: 2256-2355
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.0083
Further Details:      
 
Domain Number 14 Region: 278-377
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-22
Family I set domains 0.0091
Further Details:      
 
Domain Number 15 Region: 2621-2718
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 16 Region: 2164-2262
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 17 Region: 757-845
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 18 Region: 2442-2539
Classification Level Classification E-value
Superfamily Immunoglobulin 7.57e-22
Family I set domains 0.032
Further Details:      
 
Domain Number 19 Region: 1247-1329
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 20 Region: 560-656
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 21 Region: 1896-1983
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 22 Region: 468-565
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-21
Family I set domains 0.009
Further Details:      
 
Domain Number 23 Region: 1700-1787
Classification Level Classification E-value
Superfamily Immunoglobulin 7.57e-21
Family I set domains 0.0077
Further Details:      
 
Domain Number 24 Region: 2886-2983
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 25 Region: 202-285
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 26 Region: 2716-2807
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 27 Region: 105-191
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.0058
Further Details:      
 
Domain Number 28 Region: 1609-1704
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-20
Family I set domains 0.0067
Further Details:      
 
Domain Number 29 Region: 12-98
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 30 Region: 649-750
Classification Level Classification E-value
Superfamily Immunoglobulin 2.06e-20
Family I set domains 0.008
Further Details:      
 
Domain Number 31 Region: 1971-2072
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 32 Region: 375-470
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 33 Region: 3547-3692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 34 Region: 3095-3153
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 6.67e-16
Family TSP-1 type 1 repeat 0.00018
Further Details:      
 
Domain Number 35 Region: 3039-3096
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000249
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 36 Region: 3153-3210
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000379
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 37 Region: 2984-3034
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000106
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 38 Region: 3267-3324
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000785
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 39 Region: 3209-3267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000549
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 40 Region: 3690-3810
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000143
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 41 Region: 3882-3936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000402
Family EGF-type module 0.007
Further Details:      
 
Domain Number 42 Region: 1828-1889
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000513
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006876
Domain Number - Region: 3924-3964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000474
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006876   Gene: ENSCPOG00000007630   Transcript: ENSCPOT00000007703
Sequence length 4087
Comment pep:novel scaffold:cavPor3:scaffold_12:34668006:34816264:-1 gene:ENSCPOG00000007630 transcript:ENSCPOT00000007703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPSIKGGNATSEVSALINSIVKLECEARGLPVPAITWYKDGQLVISSSQALYIDKGQFL
QIPRAQVSDSATYTCHVTNVAGTTEKSFHVDIYVPPMIEGDSPTPLKKQVVVAHSVTLEC
KAAGNPSPSLTWLKDGVPVKASDNIRIEAGGQKLEIMSAQEVDQGQYICVATSVAGEKEI
KYELDVLVPPFVEGGDETSYFIVIVSNLLELDCQVTGSPAPAIMWLKDGQLIDERDGFKI
LLNGRKLVIAQTQMSDTGLYQCVATNTAGDHRKEFEVTVHVPPTIKSSGLSERAVVKYKP
VTLQCIANGIPNPSITWLKDDQPVNTAKGNLKIQSSGRVLQIAKALLEDAGRYTCVATNA
AGETQQHTQLHVHEPPSLEASGKMLNETVVVNNPIQLECKAAGNPLPVISWYKDSRPLSS
SASITFLNRGQIIDIESAQISDAGIYKCVAVNSAGATELFYSLQVHAVPPSISGNNNMVT
VVVNNLVRLECEARGIPAPSVTWLKDGSPVSSFANGIQILSGGRILALTSAQISDSGRYT
CVAVNAAGEKQIDIDLRVYVPPNIMGEEQNISVLISQPVELLCQSDAVPLPTLTWLKDGR
PLLKKPGLSISENGSVLKIEDTQVQDTGRYTCEATNIAGKTEKNYNVNILVPPSIYGSEE
LVQLTVIEGNLITLLCESSGIPPPNLIWKKKGSPVLPDSGGEVRMLSGGRQLQISIAKKS
DAGLYTCVASNVAGTTKKDYSLQVYIRPVITNSGSYPTEIIAARGKTISLECEVQGIPQP
AVTWMKDGRPLTQGKGFEVLDDGRILKLKNIHVSDTGRYVCVAMNVAGMTDKKYDLSVHV
PPSIIGNHGTPENISVVEKNSVSLSCEASGIPLPSITWLKDGWPVSLSSTVRILAGGRTL
RLIQARTEDTGQYICVVRNTAGEERKAFGLSVLEPPRIVGENTLEDVKVKEKQSVTLACE
VTGNPVPEITWHKDGQLLQEDKSHHIMSGGHLLQITNAQVLHTGRYTCLASNVAGDKSKS
FSLNVFVSPTIVGAGNDGSPEDVIVTLNSPTSLVCEAYSYPPATITWFKDGAPLESTRNI
RILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLLGPGLSPK
EVKIKVNNTLTLECEAYAIPSASLSWYKDGQPLKSDHHVSIAANGHTLQIKEAQISDTGR
YTCVASNLAGEDELDFDVNIQVPPSFQKLWEIGNMLDTRRNGEAKDVIINNPISLYCETN
AAPPPTLTWYKDGHPLTSSDKVMILPGGRMLQIPRAKVDDAGRYTCVAVNEAGEDSLQYD
VRVLLPPVIKGANNDLPEEVTVLVNKSVLMECSSSGSPAPRNSWQKDGKPFLEDDHHKFL
SSGRMLQILDAQITDIGRYVCVAENTAGSAKKYFNLNVHVPPRVIGPNPENLTVVVNNFI
SLTCEVSGFPPPDLSWLKNEQPIKPNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINPAG
EKRKKFSLTVYVPPSIKDRDSDSLSVVNIREGTSVSLECESNAVPPPVITWYKNGRIITE
STHVEILSDGQMLHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVLPSIEGPESEVIV
ETVSNPVTLTCDATGIPPPMITWLKNHKPIENSDSLEVHILSGGSKLQIARSQHSDSGNY
SCIASNMEGKAQKNYILLIQVPPSVAGAEIPSDVGVLLGENVELICNANGIPAPIIQWLR
NGKSITNGETEKIRVTANGSTLNIYGAHTSDMGKYTCVATNPAGEDDRIFNNCRYSFLPF
VRFLKEHCCSIFVLTLFSNNKYLKIIYSPEPHHHCLMFGWDQVIKYWITLFLRIVRVQVS
DVAMYTCVASNRAGVDTKHYNLQVFVRPHMDNAMETEELTVIKGSSTSMTCITDGTPTPS
MSWLRDGLPLRPDAHLIIGTQGMVLQLIKAETEDSGRYTCVASNDVGEVSKHFILKVLEP
PHINGSEETGEISVIVNNPLELTCMASGIPAPKITWLKDGRPLLQTDQVQSFRGNVFLRI
TNAQVEDTGRYTCLASSPAGDDDKEYLVRVHDLVPPNIAGTDEPQDVTVLQNRQVTLECK
SDAVPPPVIMWLRNGDQLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTKE
FFLTVNVPPNIKGGPQSLVILLNKSIILECLAEGVPTPKITWRKDGAILTGNHARHSILE
NGFLHIQSVHVTDTGRYLCMAANVAGTDRRRIDLQVHVPPSIAPGPTNITITVNVQTTLT
CEASGVPKPSISWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNDAGE
DKRTVDLTVQVPPTIADEPTDLLVTKQAPAVITCVASGVPFPSIHWTKNGIRLLPRGDGY
RILSSGTIEIFATQLNHAGQYTCVVRNAAGSAHRHVTLYVQEPPVIQPQPSQLDVILNNP
ILLPCEATGTPSPFISWQKEGINVIASGKNHAALPGGSLQISRAVREDAGTYMCVAQNSA
GTALGKIKLNVQVPPVISTLPKEYIIAVDKPVMLPCEADGLPPPDITWHKDGHVILESIR
QRILSSGALQIAFSQPDDTGQYTCMAANVAGSSSISAKLIVHVPPRIRSREAHYTVNENS
QAVLPCVADGIPTPAISWKKNNIPLTNLLGKYTAQPYGELVLENVVQEDSGVYTCVANNA
AGEDTHTISLTVNVLPTFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNVIPAHF
DSVNGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVYVKEPPIFKGDYPSNWIEPLG
GNAVLNCEVKGDPAPTIQWSRKGVDVEISHRIRQLGNGSLAIYGTVNEDAGDYTCIATNE
AGVVERSMNLTLQSPPVITLEPVETIVNAGGTVRLDCQATGEPHPTITWSRQAHSIRWDD
RVSVLPNNSLYIAAAHKEDTSEYECVARNLMGSVLVRVPVIVQVHGGFSPWSAWRPCSVT
CGNGIQKRSRLCNNPLPANGGKPCEGPDSEMRNCKSKLCPVNGHWSEWSLWEECTKTCGR
GNRTRTRTCNNPSAQHGGRPCEGNAVEIIMCNIRPCPVHGAWSPWQPWGECSRSCGEGIQ
IRARLCNSPPPSFDGSYCSGPETQMQVCNERHCPVDGKWTTWGSWSACSVSCGGGARQRT
RDCSDPVPQYGGSECEGSDIQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRSC
DNPGPSNGGRACAGPDTQVQRCGTDMCPVDGNWGHWQSWSHCSVSCGGGEKTRKRLCDNP
VPSKSGRSCRGDATQVSRCNTQACPGGPQRARGSVIGNINDVEFGIAFLNATVTDSSNSN
TKIIRAKITNVPRSLGTAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAIFKRETQVEFA
TGEILRMTHIARGLDSDGVLLLDIVVSGYVLQLLSPAEVNVKDYTEDYIQTGPGQLYAYS
TRLFTVDGISVPYTWNHTVFYDEAQGRMPFLVETLHASSVESDYNQLEETLGFKIHASIS
KGDRSNQCPSGFTLDSVGPFCADEDECAAGNPCSHTCHNAMGAYYCSCPTGLTIAADGRT
CQDIDECALGGHTCHPGQDCDNTIGSYRCVVHCGIGFRRTSDGLSCQDVNECQEFSPCHQ
HCFNVIGSFHCGCEPGYQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTK
AENGTCIDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGLGRPCMDINECEQVPK
PCAHQCSNTPGSFKCVCPPGQHLLGDGKSCAGLERLPHYGTQYQQSRFSPVRHNRQPQQH
YRQYSHLYSSYSEYRNSRTSFSRTRRTIRKTCPEGSEASHDTCIDIDECQNRNICQHECK
NTVGSYQCICPPGYQLMLNGKTCQDVDECLEQNVRCGPNRMCFNMRGSYQCIDTPCPPNY
QRDPVLGFCLKNCPPNDLECALSPYALEYKLVSLPFGIAANQDLIRLAYTQDGVMHPRTT
FLMVDEEQTVPFALRDENLKGVVYTTRPLREPETYRMRVRALSYSANGTIEYQTTFIVYI
AVSAYPY
Download sequence
Identical sequences ENSCPOP00000006876 ENSCPOP00000006876 10141.ENSCPOP00000006876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]