SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007011 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007011
Domain Number 1 Region: 3870-4065
Classification Level Classification E-value
Superfamily Fibronectin type III 2.61e-38
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 4531-4737
Classification Level Classification E-value
Superfamily Fibronectin type III 5e-37
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 4270-4446
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-34
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 3587-3767
Classification Level Classification E-value
Superfamily Fibronectin type III 2.65e-34
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 5 Region: 4734-4933
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-32
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 6 Region: 2139-2326
Classification Level Classification E-value
Superfamily Fibronectin type III 1.98e-32
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 1054-1244
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-31
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 8 Region: 1513-1676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-31
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 2618-2818
Classification Level Classification E-value
Superfamily Fibronectin type III 2.02e-31
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 10 Region: 2528-2671
Classification Level Classification E-value
Superfamily Fibronectin type III 1.13e-30
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 11 Region: 2817-3014
Classification Level Classification E-value
Superfamily Fibronectin type III 3.51e-28
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 12 Region: 2326-2530
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-27
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 13 Region: 1703-1890
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-26
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 1904-2053
Classification Level Classification E-value
Superfamily Fibronectin type III 6.83e-26
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 15 Region: 1243-1408
Classification Level Classification E-value
Superfamily Fibronectin type III 7.01e-24
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 16 Region: 4078-4265
Classification Level Classification E-value
Superfamily Fibronectin type III 2.74e-23
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 17 Region: 3455-3588
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-22
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 18 Region: 3018-3149
Classification Level Classification E-value
Superfamily Fibronectin type III 3.48e-20
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 19 Region: 121-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-17
Family Pentraxin (pentaxin) 0.062
Further Details:      
 
Domain Number 20 Region: 1420-1506
Classification Level Classification E-value
Superfamily Fibronectin type III 5.77e-16
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 21 Region: 4440-4535
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000394
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 22 Region: 2047-2140
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000674
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 23 Region: 3759-3866
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000117
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 24 Region: 4896-5004
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000148
Family Fibronectin type III 0.008
Further Details:      
 
Domain Number 25 Region: 847-890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 26 Region: 747-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 27 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 28 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 29 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 30 Region: 901-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 31 Region: 1003-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 32 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007011
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Laminin-type module 0.073
Further Details:      
 
Domain Number - Region: 952-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 339-421
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00442
Family APC10-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007011   Gene: ENSCPOG00000007786   Transcript: ENSCPOT00000007860
Sequence length 5227
Comment pep:known scaffold:cavPor3:scaffold_13:5451204:6104372:1 gene:ENSCPOG00000007786 transcript:ENSCPOT00000007860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCLALPPGSGFLFRVIETLIFACVASVSVAASQGLFPRLENVGAFKGVSIVPTQAVCGL
PDPSTFCDSSVAAGSTQFCTQRLCVQDCPYRSSSPPYTALFSAGGSTCVTPDKSDLCPQS
SSNSTSFIFGKHTDCFPSPPSPRLGEALTLAVWLKLEQAGEMCIIEKMVDGQTVFKLTIS
EKETTFYYRTVNGLQPPIKVMTLGRILVRKWIHLSVQVHRTKINFFINGVEEDNTAFHTG
TLSGSLSDFASGTLQIGQSLNGLEKFVGRMQDFRLYQVALTNREILEVFSGDLPRLHIQS
HCRCPSSHPRIHPLLQQYCVPNAVGDTTRHRMLRLDPDAHPLSFINDNNTGTSWISHVFT
NITELDAGVTISVDLENGQYQVFYVVIQFSSPQPTAIKIQRKKEDSLDWEDWQYFARNCS
TFGMENNGDLETSDSVNCLQLSRFSPYSRGNVTFSILNPEPKCRPGCSDFYNNPALQEFV
KATQIRLHFHGQYHTTDAGVNLGHRYYAIDEITIGGRCQCHGHANRCDTRSQPYRCLCAQ
ESFTHGLHCDRCLPLYNDKPFRAGDEAHAFACKPCQCHGHATSCHYNASLDPFPLEHGRG
GGGVCDACQHHTAGRNCELCEDYFFRQVGADPSAVDICKPCHCDGAGTRNGSLLCDQIGG
RCNCKRHVSGRQCNQCHAGFYSLQELDPDGCRPCSCNTSGTADGDITCHPNSGQCKCKAN
VIGLRCDHCNFGFKFLQSSNNEGCEPCECNLHGSVSQICHPVSGQCECKRDVRGLRCDRC
GEHFYGLDATGCKACKCHVAGSISGTICDAETGQCRCKPNVGGRQCGECVEGYFSRWQND
SFRCLPCHCDKSGTVNGSLLCDKVTGQCPCRSGVTGLLCDQCEPHRYNLTTEGHFQSCAM
CECDSLGTLPGTTCDRISGQCVCLPRRQGRRCDRCQAGFYIAPGNATGCLPCSCHTSGAA
GRVCDGLTGQCLCQDTSVTGHRCDRCSDHHFGFDPQTGRCQPCNCHLSGALNETCHLVTG
QCFCKQFVTGTKCEACVPGASHLDVHNPWGCSKTPSQQPPPRGQVQSSSAISLSWSPPDS
PNAHWLTYRLFRDGSEVHTTEDQYPYSTQCFLDTALSPYTTYSYHIETTNVHGSTRSAGV
MYTTKPGLPQGHLNLSYVIPVSSDSVTLTWNALSNHSGPIEKYILSCVPLDNLTSCIPYE
GHETSATIWGLIPFTKYQFSVQACTSGGCVQGSPVTVTTAQAPPQRLSPPKIRRVSSSEL
HAEWAPPAEPNGIVTKYELYMQRSGSTEERRVFQSSSWLGPQPSAEPADGTAQRPLQTAA
TITGLEPYTEYAFKVSAENVVGSVSSVWISERTGESAPVLMGTPSVSPLSSRSLNVSWEK
PPENVTRGRVMGYSISLVSEQSPQQSSPVVLQQLLHTAQSQELSYIVTGLKPYRMYAFTV
SLCNSIGCVTSAAGVGQTLAAAPAQLRPPQIKGLNSTTIHLTWFPPEEVNGPSPLYQLER
RESSLPALAATVMKGTRFTGNGYYKFPSTTHPVGTDFTGLKASFRTRVSEGLILFAASPG
DQEEYFALQLKEGRPYFLFDPQGSPVVVTTTDDDGKQYSDGQWHEITAIRHQAFGRITLD
GQYSGSGAAPNGSTIIGDNAGLFVGGLPQGHAILRKEAEIIQKGFVGCLKDVHFMKSYNP
SAIWEPLDWQSSEEQINVYDSWEGCPASLNEGVQFLGAGFLQLHPGVFRGGMDFEISLKF
RTDQVNGLLLFIYNKDGPDFLAVELKSGVLSFRSNASLTFAQVDLWLGLSYCDGQWNDVV
IEKHGPRLAAGVNAQTQRYSASAARALVVNSPVYVGGIPQELRGAFGHLSLEQGFGGCVK
EVAFAHGAVVNLASVSSLAVRVNLDGCLSPASAANCRGNDSIMVFRGHQHSAHDSGLQPF
TEYLYRVRASHEGGSVYSDWTRGRTMPTAPQSVPAPSSIRSIDGYSVEVTWDEPAGVTGV
IEKYVLRAYSGDDPSVPRTPSASTECVDTSTFTATLTGLLPFRNYAVTLTACTLAGCTES
SQAVNISTPQEAPKEVQSPVAKSFPTSLLLSWNPPKQANGIITGYSLYMDGKLIYSGSEE
NYTVTDLGVFTSHHFLLSACTHVGCTNSSWVPLHTAQLPPEHVAPPVVTVLDSRTVDVQW
KQPGKLNGILEHYILYISNRTHGFPVWAVVYNSSESSLGHKLQDLIPGTEYLIKLGACTG
GGCAVSEASQALTDEDVPEGVAAPAAHSYSQDSFNVSWTLPEYPNGVITSYGLYLDGVLI
HSSSERSCHADGLAPGSLHSFRVQACTAKGCALGPTVENRTLEAPPEGTVNVFVRAEGAR
EARVKWGAPLHPNGLLTYSVLVTGTFYADPAGNNYTLLSGTRIMHSSGEANLWVPIVGLV
PFSNYTVQVNASNSRGSLISDPATIVMPPGAPDGVLPPRLSSATPTSLQVVWSTPARNNA
PGSPRYQLQMRLARSTLGFLELFSNPSASLHYEVSDLQPYTEYEFRLVASNGFGRAHSSW
ISLLTAEDKPGPLEPPILLDVKSRMMSITWQHPLKPNGVITHYNIYQQGDLYLRTSGNVT
NCTVAHLQPNTAYKFQIEACTSQGCSISPESQPVWTLPGPPGGILSPELFSDTPTSVLIS
WQPPTHPNGLVENFTIERREKGKEETTILVTLPGSHARRFTDKTPALSPWTKYRYRVLMS
TRNGGTNSSAWGEVTTRPSRPLGVQPPEVHVLGPREAQVTWQPPLVRNGDILSYEIRMPD
PCITITNVSSSEVSSHTVTHLIPFTNYSVTIVACSGGNGYLGGCTESLPTLVTTHPTAPQ
GASPLSVIPLSESYVGISWQPPSKPNGPNLRYELVRRKIQQPLASNPPEDLNLWHNIYSG
TQWFYEDKGLSRFTTYEYKLFVHNSVGFTPSQEAKVTTLAGFPERAANLTVTVLNHTAID
VRWAKPTFQDLQGDVEYYTLFWSSATSNESLRILPGVKSYVIGHLKPNTEYFIFISVFNG
AHSINSTVLRAITCDGEPQGMLPPEVVIINRTAARVIWSSPSNPNGAVTEYSIYVNNQLY
KTGMDVPGSLVLRDLSPFTVYDIQVEVCTKYACAKSNGTQIATVEDTPSDIATPVIHNIT
SRSLRIDWVSPGKPNGIILGYELLRKTWHPCSKTWKLMEDHSDELCKAVRCPKPQKICGH
ICFSPKAKVCCNGVLYDPQPGYHCCEEKYLPFLPNSTGVCCGGRIQEAQPDHECCYGYYA
KVLPGEICCPDAQHERVSVGLGDACCGRMPYASSGHQICCAGVLHDGRGRQCCGGQVVSS
AVRCCGGEVRGLVYPALPGMLCCGQDYVNMSDTICCSASSGESEAHVKMNVAEPGKCCET
ELIPESQKCCNGVGYNPLKYVCSDKISTAATMKGTRACGTLCPASMEATAHCGRCDFNST
SHVCVVTTGSHNFTGKASTEETCPSLEDTVHMGSTDTFSFTDMYLKPYTMYEYRISAWNS
YGQGFSQTVRASTKEDAPEGVHPPRWTKVGDLEDTIVLHWKKPIQSNGPIIYYSLLRNGV
ERFRGTSLSFSDTEGIQPFQEYCYQLAACTVAGCTTSRKVVVTMTQGVPESVRPPSITPL
NAESLHLSWSVPGKPNGVIKQYQLWQGGRGLIYTDITHRRQHTVTGLQPFTNYSFSLTAC
TSAGCASSEPFLGQTPQAAPQGVWVTPRHTVINSTSVELYWSPPEKPNGLISQYRLSRNG
TLLFVGGGEEQNFTDKHLEPNSRYVYKLEARTGGGSGTSDAYIVQTPLWTPEEIHAPYNI
TVVGPYSIFAAWTPPGILIPQIPVEYHVLLNDGSVTPLTFSVGHLQSTLLENLAPFTQYE
IRIQACQNGGCGVSSRVSIKTSEAAPEDLGPPLLKVLGSSCVEVQWMPPNKPNGIITKYF
IHRRPAGTEDASLVFAWSEGALQFTDDAGTLRPFTRYEYRARAQNSKGSVNSDWSSTQTL
EAPPQALPAPQARATSAHSVLLTWTEPESPNGHISQYRVVYRERHEDPGPGSTPVPAFTV
TGTSRQAQLFGLEPFTTYHVAVVAVNHAGDVSSPWTLVQTLESSPSGLSNFTVDQRENGR
ALLLQWAEPMRTNGVIQAYGVFSEGLPEYRGPGRSLLLRRLRPGSVYTLSLEACTAAGCA
HSAPQRLRTGEGAPESQPAPAVRVVGPTHVELRWSEPASPHGKITRYAVVRRCEGDLTRG
NWTTQAQAEERTVFVEHSPPERGAFGYTDTGVQPWTPCEYRICTWNSAGHTCSAWSAVRT
LQALPEGLSPPELAWVSRDPPALLISWTPPEQPHGVVQSYGLQKNGVRYPFSFDAGTLSY
TDDDLLPFSTYSYAVLACTLAGCSTSKAAQVTTPEAAPSGLSPPTLCAVSASQINASWSP
PSTPNGAITGYLLRYDNKEQPAGQGLTLLVSHLQPCTQYNFSLVACTSGGCTVSESRSAW
TMEAPPENMGSPVLLVTSSESIEVTWEPPRNPNGRIRSYELRRDGAVVYTGPGTRYHDAP
LTPGVEYGYTVTATNSQGHTSSPLVKHRTSPSAPSGMRPAELHTQGPREIIVSWDPPART
NGDIVNYTLIIRELFQGETRAVHINTTHGSFAERSLVVEQLKPFSRYEVRIQACTALGCA
SSDWTSIQTLEMAPQMQPPPHVEVGTAPGGFRPTVSLLWTGPLQPNGNILHYELYRRQTE
TPSGKSNPVLTYNGSSNSFMDSDLLPFTKYEYQVWAVNSAGKAPSSWARCRTQPAPPEGL
SAPSVHAVSSTQAVLNISVPSKPNGDISLYRLFSNTSGVLAVLSEGTATQQTLHDLRPFT
SYQVGVEACTCLNCCSRGPTAELRTRPAPPSSPSAPRVLELGSRTASVQWGPPLFPNGVL
RSYELQLSAACSPDAAPACAPSQAETRYRGLGLGASLGGLQPYSAYRLRVVAHNEVGSRA
SEWTRFTTHKELPQYRMPFSVESNASVVCLDWSSSFLLNGRLKEYVVTDGGQRVYSGLDT
TLHIPRTVHKTFFFQVTCTTDIGSVKTPLIQYDTSTGFGLVLTTPGGKRGSGSKSREFYS
ELWFIVLMAMLGLILLAIFLSLILQRKIHREPYIRERPPLVPLQKRMTPLNVYPSRETPV
FDSVADISDVSSNVTLKSYTMRFEGLADTKIPRSGTPVSIGSNRSVSVLRVPSQSQLSQA
YSQGSLHRSVSQLLDGQDKKVLLDDSLWETIVGHSSGLYVDEEDLMNVIKGFSSVTKEHT
TFTDTQL
Download sequence
Identical sequences ENSCPOP00000007011 10141.ENSCPOP00000007011 ENSCPOP00000007011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]