SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007016 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007016
Domain Number 1 Region: 24-170
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-47
Family Link domain 0.000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007016   Gene: ENSCPOG00000007792   Transcript: ENSCPOT00000007866
Sequence length 792
Comment pep:novel scaffold:cavPor3:scaffold_92:3680009:3731412:-1 gene:ENSCPOG00000007792 transcript:ENSCPOT00000007866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKFQWAGQRGRPVLALGLSLRQPIDLNITCRYAGVFHVEKNGRYSISRTEAADLCEAFNT
TLPTMAQMERALHHGFETCRYGFIEGHVVIPRITPNAICAANNTGVYILTSNNSHYDTYC
FNASAPLDKEDCASVTDLPNSFAGQVTITIVNRDGTRYSKKGEYRTHQEDIYPINSTNPI
SPMDEDVSSGSPSERSTYGGYSIFHTLLPTAHPTSDQMNTEVYGSTRDTLALTLTSNIHA
AVKEQSDWIWSWFGNTNLQTQDLTTATTVMVTTTLMSTNGATLETATKRQETQECFSWLF
KLSDSRSHLHTTKMDGSTDSNTMSAGWEHSEENEEDRDKHLSFSGSGIDDDEDFISSTIS
TTPRVSDHTKQYQDWNQWKPSHSSTEVLLQTTTRMTDVDRNGTSVYEESWTQDAQPPLIH
HEHPDKEETPHPPSTTWAAPSSTAEETATQKEQWSEDGWHGEYPQTPREDSGSTAGTTVS
AHDSHPSQRMTTQSQEDSSWTEFFDPVSHPMRRGQQTEKTMDMDTSHSTIQPTAVPNTDL
VEDLNRTRPHSVTTQQSDSQSFSTSHGELEEDKEQPTTSTLTSGNRHPAIEGRRDGNLSE
DSTTSLEGYTPHYPDTKENRTLIPVTPASTGAFGETEVTVVGEHNYDVDHHLPGDQDSSV
DPNRGSHTTSDSASHGRASGTQGGANTTSAPIRRAQIPEWLIILASLLALALILAVCIAV
NSRRRCGQKKKLVINNGNGKMEDRKPSGLNGEASKSQEMVHLVNKEPSETPDQFMTADET
RNLQNVDMKIGV
Download sequence
Identical sequences ENSCPOP00000007016 10141.ENSCPOP00000007016 ENSCPOP00000007016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]