SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007034 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007034
Domain Number 1 Region: 33-144
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-30
Family Link domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007034   Gene: ENSCPOG00000007811   Transcript: ENSCPOT00000007886
Sequence length 313
Comment pep:known scaffold:cavPor3:scaffold_67:1455337:1467263:-1 gene:ENSCPOG00000007811 transcript:ENSCPOT00000007886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKYFNLVLLLASVWTTRLLVQGSVRVQELVAMSCRIMGVALVQKKIEPQLNFTEAKEAC
KLLGLSLASKIQVETALLSGFETCSYGWVAEQYPVIPRINQNPKCGKNGKGILIWKAKAH
QKFRAYCHNSSDIWVNSCVPEIITTPEPLSDFETETYSVEFTASDSTFSASAPYSTTPAP
ATTPARAATSRRKKLICITEVFTETSSVPTETESSFENGAMFKNEAPGFGGVPTTLLVLA
LLFFSAAAGLAVCYVKRYVKAFPFTNKNQQKEMIETVVKEDKADDEESKKTDNNPEEPKT
PPKTTVRCLEAEV
Download sequence
Identical sequences ENSCPOP00000007034 10141.ENSCPOP00000007034 ENSCPOP00000007034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]