SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007117 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007117
Domain Number 1 Region: 252-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000368
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 2 Region: 126-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000494
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 73-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000225
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 30-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007117   Gene: ENSCPOG00000007906   Transcript: ENSCPOT00000007981
Sequence length 758
Comment pep:novel scaffold:cavPor3:scaffold_781:924:31701:-1 gene:ENSCPOG00000007906 transcript:ENSCPOT00000007981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGARLLLLWGCCCVPSWGSTDLYTTSADQDENECLDTTACPAYSTCHNTVGSYFCTCKP
GFEASNGQSRFTGRGVQCQDVDECSRSPPACGPHSVCRNLRGTFSCSCRPGFSSPSGDGW
RPGMAGRFACTDTDECLAGGACPEHADCTNFPGGFNCSCRAGFEARGAVCADIDECLSSG
ICPENAYCNNSLGNYTCHCLPGFMHVYSMCKDIDECTYSCPPNASCTNTLGSFFCTCKAG
FAPSNGRWNFTEPEVTCVDVDECSPAPSPCGPHSVCSNVLGSYNCSCSPGFRPDPEGSMT
HGNFSCRRVPFKCREDIIPNSTETRHCQKGRAADPKYGQGSFCRLMNATFSVLDVACKNK
TSVSLKNKTESLASVLNETSAWAKFTKKEKSALATALLESVESATLAALLTSPENASQIV
STQQLVIRTRVISDACTGENVSFTLEANGDVMRIGCATIKESESTGTTGVAFVSYTNMQS
VLDEQFFRDPQARWGTERRKLRMSSRVVGGIMTGQRKDNFSKPVVYTLQNTQPKRTPEEK
AICVSWVTDTEGGRWTPSGCKTLRQSKTHTTCSCYHVASLAVIMASGEPTMEFPLYVISH
VGIVLSLVCLIAAIATFLLCRAIRNNNTYLHLHLCVCLFLAKLLFLAGINETSNQTGCAV
IAGLLHYLFLACFSWMLVEAVMLFLMVRNLKVVNYFSSRNLKVLHLCAFGYGLPALVVVI
SAGVQPQGYGMHDRCWLNTDTGFVWSFLGPVCTIIVVS
Download sequence
Identical sequences 10141.ENSCPOP00000007117 ENSCPOP00000007117 ENSCPOP00000007117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]