SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007246 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007246
Domain Number 1 Region: 165-248
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.02e-22
Family Thyroglobulin type-1 domain 0.00000983
Further Details:      
 
Domain Number 2 Region: 22-99
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.1e-20
Family Growth factor receptor domain 0.0000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007246   Gene: ENSCPOG00000008055   Transcript: ENSCPOT00000008130
Sequence length 254
Comment pep:known scaffold:cavPor3:scaffold_53:10901988:10908826:1 gene:ENSCPOG00000008055 transcript:ENSCPOT00000008130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLGLVGALLMARRPARREPFHCTPCTEELARCRPPVGCEELVREPGCGCCATCALGLG
MPCGVYTPRCGSGLRCYPPRGVERPLRTLMHGQGVCMEPAEIEAIQDSLQPADKDEGEHP
NNSFSPCSAQDRRCLQKHLAKLRDRSSSAGKMKVVGAPREDARPVPQGSCQSELHRALER
LAASQGRTHEDLFVIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEAK
GELDCHQLADSFRE
Download sequence
Identical sequences ENSCPOP00000007246 ENSCPOP00000007246 10141.ENSCPOP00000007246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]