SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007253 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007253
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000149
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007253   Gene: ENSCPOG00000008067   Transcript: ENSCPOT00000008142
Sequence length 184
Comment pep:known scaffold:cavPor3:scaffold_29:7144137:7150928:1 gene:ENSCPOG00000008067 transcript:ENSCPOT00000008142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLLLLTTLLVPAHLTVAWSTKYAVDCPEHCDNSECRSSQRCKRTVLDDCGCCQVCAAG
LGETCYRTVSGMDGMKCGPGLRCQFYSEEDDFGDEFGICKDCPYGTFGIECKETCNCQSG
ICDRVTGKCLIFPFFQYSAATSSTRRSISHTDHDMASGDGNSMTEDIMKKNAAQSPVMKW
LNPR
Download sequence
Identical sequences A0A286XTF6
ENSCPOP00000007253 10141.ENSCPOP00000007253 ENSCPOP00000007253 XP_003470219.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]