SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007344 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007344
Domain Number 1 Region: 1416-1712
Classification Level Classification E-value
Superfamily BEACH domain 5.36e-124
Family BEACH domain 0.00000000921
Further Details:      
 
Domain Number 2 Region: 1810-2080
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.7e-32
Family WD40-repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 1285-1370
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-21
Family PreBEACH PH-like domain 0.0052
Further Details:      
 
Domain Number 4 Region: 138-288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000145
Family Laminin G-like module 0.057
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007344
Domain Number - Region: 591-734,830-905,938-997
Classification Level Classification E-value
Superfamily ARM repeat 0.000624
Family Armadillo repeat 0.054
Further Details:      
 
Domain Number - Region: 23-83,437-457,485-631
Classification Level Classification E-value
Superfamily ARM repeat 0.00299
Family Armadillo repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007344   Gene: ENSCPOG00000008167   Transcript: ENSCPOT00000008242
Sequence length 2121
Comment pep:novel scaffold:cavPor3:scaffold_7:47586427:47600071:1 gene:ENSCPOG00000008167 transcript:ENSCPOT00000008242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPPPIRNEQPVLVLMQWLPALPSGELQLFLAQRLRWLCDSCAASRAACVRAGLVGSLLE
TLNVGSALGPQCQEQLLALLQALGRVSLRPLELRRLLRPPPGLDSDRAEAERARHAGAVI
RALSGMARHQEPARSLHYFDLTPSMAGIMVPPVQRWPGPGFTFHAWLCLHPTDPAPVPAP
ARPLQRKQLYSFFTSNGSGFEAFFTAEGTLVVAVCTRKEYLSMSLPEVSFANSAWHCVAI
VHVPGRRPFSQNLLHIYKDGHLVKTAPLRFPYLNEPFSSCCIGSAGHRTTITTTGLPMAP
VPTALTPTHPSLTRSQSVPASSGLGWGSGLVAPLQEGSISSTLAGTQDTQWGSPTSLEGE
LGAVAIFHEAVPAAALRTLCALGPNEPAPFKPEGDLHELGAKLLLHYSPQACKNNICLDL
SPSHGLDGRLTGHRVETWDVKDVVNCVGGMGALLPLLDRVAAQPLEAEAGPAETHDLVGP
ELTSGHNVQDLRLPLGKSSEDRMEKNAVAAFLLMLRNFLQGHTVNQESLVQCQGPAIIGA
LLRKVPSQGMDMNVLMSAQLLMEQVASENRGTLLYLLYQHLLFNFHLWTLSDFAVRLSHI
QCMTSIIREHRQKLRRKYGVQFILDALRTHYGPQRERPLVADDLRTVQTSLLGLARELLV
RSFSAEDLQVLLNFLAAMGDDNQILRRLQQNERLPERSRQRLRLRDSGLLGLTACLPKGT
SSPQLCQGLYSLFLGAGSGTMAISGSSSGTLTPASQPGTPSPLDGPRPFPATPGRHSSSL
SNVLEDGSLPEPAVNGDDTSNTSNPQQTPEEELCNLLTNVLFSVTWRGVEGSDEAAWRER
GQVFSVLTQLGASATLVRPPDYIKRSLLEMMLESALTDIKEASPGALANLTQQALWLLRL
LQDFLCAEGHGNQELWSEKLFEGVCSLLDRLGAWPHLANSTADLREMAQIGLRLVLGYIL
LEDPQLHAQAYVKLHTLLQTSVPTRREEACYMLSKLEAALGRALTASQEEVAVERTQSPA
AAAASERCSWLVPLVRTLLDRAYEPLGLQWGLPSLPPTNGSPTFFEDFQAFCATPEWRQF
IDKEVQPTMSQFEMDTYAKSHDLMSGFWNTCYDMLMSSGQRRQRERAHSRRAFQELVLEP
AQRRVRLEGLRYATALKQQAAQYSVALLHWEATWRQLSSPCGAWALREPPAPHWKLSSAE
TYSRMRLKLVPNHHFDPHLEASALRDNLGETCLMPTEEASLPLAVTKEAKVSSPAEELQE
DQLGEDELAGLETLMEATELDEQHEKLVLSAECQLVTVVAVVPGLLEVTTQHIYFYDGST
DRVETEEGIGHDFRRPLAQLREVHLRRFNLRRSALELFFIDQSNYFLNFPCRAAGASTSS
PSQVSRAQPSTSASHTHVRNQVYSWLLRLRPPAQGYLSSRSPQEMLRASGLTQKWAQREI
SNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQDYVSPTLDLSNPAVFRDLSKPIGVVNPKH
AQLVREKYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIRVEPFTSLHVQLQSGRFDCSDR
QFHSVAAAWQARMESPADVKELIPEFFYFPDFLENQNGFDLGCLQLNNEKVGDVVLPPWA
SSPEDFIQQHRQALESEYVSAHLHEWIDLIFGYKQRGPAAEKALNVFYYCTYEGAVDLDH
VADARERKALEGIISNFGQTPCQLLKEPHPPRLSAEEAAQRLARLDINTPSLFQHLDQLK
AFFAEVVSDNVPLVLALVPHRQPHSFITQGSPDLLVTVSANGLLGTHNWLPYDRNINNYF
SFSKDPTIGNPKMQRLLSGPWVPGSGVSGQALAVAPDGKLLFSGGHWDGSLRVTALPRGK
LLNQFSCHLDVVTCLALDTCGIYLISGSRDTTCMVWRLLQQGGLSIGLAPKPVQVLYGHE
AAVSCVAISTELDMAVSGSEDGTVIIHTVRRGQFVAALQPPGAALPGPVSHLALGSEGQI
VVQSSTRERPGAQVTHTLYSYSVNGKLQASLPLAEQPTALAVTEDFVLLGTAQCTLHILH
LNKLLPAAPPLPMKVPIRSVAVTKERSHVLVGLEDGKLIVVGAGQPSEVRSGQFARKLWR
SSRRISQVSSGETEYNPCEAR
Download sequence
Identical sequences 10141.ENSCPOP00000007344 ENSCPOP00000007344 ENSCPOP00000007344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]