SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007526 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007526
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-34
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 2 Region: 351-487
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-33
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 3 Region: 1374-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-28
Family C-type lectin domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1107-1226
Classification Level Classification E-value
Superfamily C-type lectin-like 1.09e-27
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 5 Region: 949-1093
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-27
Family C-type lectin domain 0.0052
Further Details:      
 
Domain Number 6 Region: 1533-1663
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-27
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 7 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-26
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 8 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.68e-24
Family Cysteine rich domain 0.0072
Further Details:      
 
Domain Number 9 Region: 501-625
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-19
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1242-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-18
Family C-type lectin domain 0.0056
Further Details:      
 
Domain Number 11 Region: 798-932
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-17
Family C-type lectin domain 0.019
Further Details:      
 
Domain Number 12 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-16
Family Fibronectin type II module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007526   Gene: ENSCPOG00000008372   Transcript: ENSCPOT00000008447
Sequence length 1723
Comment pep:known scaffold:cavPor3:scaffold_3:28728824:28823380:1 gene:ENSCPOG00000008372 transcript:ENSCPOT00000008447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQARRATPRRAAGLLALLLPCFGLVQPSDRTGNDAFTIVSENTGKCIKPLDNWIVAKDCE
ETGDLRWKWVSQHRLFHLQSQKCLGLDITQPVVTLRMFSCDSNAMLWWKCDHYSLYSASQ
YRLTLKDGYAIASTNTSDIWKKGGSEESICAQPYHEIYTRDGNSYGTPCEFPFLVNGTWH
HDCILDEDHSGPWCATTLNYEYDQKWGICLKPENDCEGNWEKNEQTGSCYQFNTQAILSW
KEAYVSCQSQGADLLSIKSAAELTYLKGKENIPKSFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDIPSAPIIGGSSCARMDAESGLWQMIFCEAKLPYICKKPLNNTTELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESGSWDEAQIKCKAFSGDLISIHSLADVEVVVTKLHNGDAQEE
TWTGLRNINIPTLFQWSDGTEVTLTYWDENEPKVPYNKTPNCVSYLGKLGQWKVQSCEEK
LKYVCKKKGEKMNDSKLDKMCPLGEGWKRHGETCYKIYKDEVPFGTNCNLTITSRFEQEY
LNDMMKKYDKSLQKYFWTGLRDVDSHGEYSWATMGGVKQAVTFSNWNWLEPASPGGCVAM
SPGKSLGKWEVKDCKNFRALSICKKISKPLEPEEAAPKPDGPCPEGWHTFPSSFSCYKVF
HVERIIRKRNWEEAERFCQALGAHLPSFGHMNEIKEFLHLLKEQFSVQRWLWIGLNKRSP
YLQGSWQWSDNTPVSTIIMESEFQEDYDIRDCAAVKVSHSPWRRSWYFYDEREYIYLRPF
ACDAKLEWVCQIPKGSTPKTPDWYNPERAGIHGPPVIIEGSEYWFVADPHLNYEEAVLYC
ASNHSFLATLTSFTELKAIKNKIANISDVEQKWWVRTNDQRIHHRYIYSRHPWHHFPMIS
GEECLYMSAKTWLTDLSKPTDCRTKLPFICEKYNVSSLEKYSSSTAAKVQCSEPWIPFQN
KCFLKITSKSVTFSQASDVCQSYGGTLPSVLSQSEQDFITSLLPSMETDLWIGLRWTAYE
KIGKWTDNRELTYNNFHPLLIDWRLRMPERFFDEDSHYHCALILNFPKSPFTGTWNFTSC
AERHSVSLCQKYSDTEVKDRRPLPNTSETIKYLNNLYKIIPKTLTWYNAQRECAKEKMRL
VTITDPYQQAFLTVQVVLWNSSFWIGLSSQDDERNFGWSDGKRLHFSRWAENSKQLEDCV
ILDTDGFWKTADCNDNQPGAICYYPGNETEVKPVDKVKCPSPALNTPWIPFQNSCYHFML
TKNRHTAMTQDEVHSKCQKMNSRSHILNIRNEKENEFVLEQLLHFNYMASWVLLGITYEN
NSLMWFDKTMLSYTHWRTGRPTVKNGKFLAGLNVDGLWDIQTFNVIEEILPFYQHSILAC
KIEMVDYKEEYNTTLPQFIPYEDDVYNVIQKKVTWYEALNTCSQSGGYLASVHNQNGQRF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSALDYIPWKNQKSPGNCVILDPKGIWKHE
KCNSVKDGAICYKSTKPKELSLHTHSSRCPAAKENRSQWIQYGGHCYATDQALHSFSEAK
QLCRELADHSATIVSIKDENENKFVSRLMRENNNITMRVWLGLFQHSVDQSWNWFDGSGV
TFVKWENKSKSGDGKCTILLASNETWKKVECSHGYGRVVCKVPLGPDYKAISITFAVLSC
LALISGLIWFLFQRNRFRWAGSSSVRYEQGMNEDEIVFPFFHD
Download sequence
Identical sequences ENSCPOP00000007526 10141.ENSCPOP00000007526 ENSCPOP00000007526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]