SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007782 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007782
Domain Number 1 Region: 110-441
Classification Level Classification E-value
Superfamily Subtilisin-like 1.31e-98
Family Subtilases 0.00000000000526
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-43
Family Proprotein convertase P-domain 0.000000409
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.7e-24
Family Prohormone convertase 1 pro-domain 0.0023
Further Details:      
 
Domain Number 4 Region: 585-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000457
Family Growth factor receptor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007782   Gene: ENSCPOG00000008665   Transcript: ENSCPOT00000008743
Sequence length 796
Comment pep:known scaffold:cavPor3:scaffold_10:33832908:33839646:1 gene:ENSCPOG00000008665 transcript:ENSCPOT00000008743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRPWLLWVVAAAGALVLLAADARGQKIFTNTWAVHIPGGLAVADSVARKHGFHNLGQI
FDDYYHFWHRAVTKRSLSPHRSRHNRLQREPQVRWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGITQRDLNVKEAWAQGYTGRGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVRTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCVIDILTEPRDIGKRLEVRKTVTACLGEPTH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEVENTSEANNYGTLTKFTLILYGTAPEGLPTSPESSGCKTLTSSQACVVCE
EGFSLHQKTCVQHCPPGFTPEVLDTHYSTENDVETIRASVCAPCHPSCATCQGPAPTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPEQPPQLPSLTQEMEAEPRPVAGLLPSHLPEVIA
GLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEED
EGRGERTAFIKDQSAL
Download sequence
Identical sequences H0VCV1
ENSCPOP00000007782 XP_003475803.1.53824 XP_013014057.1.53824 XP_013014058.1.53824 XP_013014059.1.53824 XP_013014060.1.53824 10141.ENSCPOP00000007782 ENSCPOP00000007782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]