SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007852 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000007852
Domain Number - Region: 2-18,131-223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0133
Family Growth factor receptor domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007852   Gene: ENSCPOG00000008747   Transcript: ENSCPOT00000008825
Sequence length 307
Comment pep:novel scaffold:cavPor3:scaffold_87:4289945:4311078:1 gene:ENSCPOG00000008747 transcript:ENSCPOT00000008825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYICLCTEGYYFNSGACLRGKTFPGLITVKGNDVSDLQNGGSLAYENFWNDTTTFFQSAF
AKTDYKQTVIHTIRCTALSLKETKAKNQLIMAKVVNIFEQNTTENETSVSAKINDTITNS
NNILAYSGENRCDYYGCKDDPQDNCLSGSNCQCKDGLQRPFLQSPFCLETFQCPKDCNPE
NKKQCLKDSTGRVVCKCLPGYRKTDGDDACQECPFGYSGMNCEDKFQLILTIVGAVLGVL
VLGLLIALVISVSSSNKKNIEEQNLIENDFQNLHLQHTAFSNPKTKGSLFPEVRTQPSRA
HQGFNPY
Download sequence
Identical sequences 10141.ENSCPOP00000007852 ENSCPOP00000007852 ENSCPOP00000007852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]