SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007897 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007897
Domain Number 1 Region: 360-470
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-16
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 466-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000326
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 3 Region: 193-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000194
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 293-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 250-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 512-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000656
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007897   Gene: ENSCPOG00000008797   Transcript: ENSCPOT00000008875
Sequence length 691
Comment pep:novel scaffold:cavPor3:scaffold_216:203072:251515:-1 gene:ENSCPOG00000008797 transcript:ENSCPOT00000008875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVCSLPRTVDADVLMEACCADGHRMATQHKDCSLPYAPESKECRMVQEQCCHSQLEELH
CTTGINLANEQYSCSTPPGDNTSLEAMFVKRCCHCCLLGRAAQAQAQSCEPSLMLGYQCG
LVFRACCVRGQESTDFAPGDVGDPQENAKIAAAEEEQEDPYLNDRCRGEWRPCKQQCRDT
GTSVCCFVGYQLMPDGVSCEDINECITGSHSCRLGETCINTVGSFRCQRESSCGTGYELT
EDNDCKDAPDIDECENGIHNCPPDFICQNTLGSFRCRPKLHCKSGFIQDALGSCIDINEC
LSISAPCPAGQACINTEGSYTCQKNVPNCGRGYHLNEEGTRCVGWYQKRGNRAEADLGHR
CLNTPGSFRCDCKAGYYFDSISRTCVDINECQRYAGRLCGHKCENTPGSYHCSCSVGFRL
SVDGRSCEDVNECLSSPCSQECANVYGSYQCYCRRGYQLSDLDGVTCEDIDECALPTGGH
ICSYRCINIPGSFQCSCPSTGYRLAPNGRNCQDIDECVTGIHNCSVNETCFNIQGGFRCL
AFECPENYRRSGDTLRQEKTDTVRCIKSCRPGDMACIRDPVHTISHTVVSLPTFREFSRP
EEIIFLRAVTPLYPANQADIIFDITEGNLRDSFDIIKRYTDGMTVGVVRQVRPIVGPFHA
VLKLEMNYVVGGVVSHRNVINVHIFVSEYWF
Download sequence
Identical sequences 10141.ENSCPOP00000007897 ENSCPOP00000007897 ENSCPOP00000007897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]