SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008368 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008368
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000111
Family Link domain 0.039
Further Details:      
 
Domain Number 2 Region: 102-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000564
Family Complement control module/SCR domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008368   Gene: ENSCPOG00000009325   Transcript: ENSCPOT00000009410
Sequence length 597
Comment pep:known scaffold:cavPor3:scaffold_16:41026621:41081389:1 gene:ENSCPOG00000009325 transcript:ENSCPOT00000009410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKLFVLESQNSTQGLDLETAQLFCKSRGAHLVSVDELRRVVQDCAFAVCTTGWLADGTLG
TTVCSKGDGEQQTMRAVGVRIEDSPAPGGMYSALCIKDEEKPCGDPPAFPHTILQGRTGL
DMGDELLYVCAPGSVAGHQETAFTLLCNSCGEWYGLVQACGKDEAEAHIDYEDNFPDDRS
VSFRELMEDSRSVIEEDKGQTEASEEAPKQDRLVSISVRKENIARHKPFVPNTGLPGTRR
AVPTDLPKSQLNQKYLLWLPAETFHKPDVERDVGDNSQKQFPAGDNHRTVKLVPSEPETR
SRVTYGSTDGPLGSSVDRNDSKAAALVGSSSDESWLDGYPVTDRAWRKAEAEEEDDGDKG
PGSVRLDDSVLVTPDQPALMEVKMPKSTTLTPGKVMTHTSVVPSEVLDVEVLALRPTNVS
ETEGPQDSDDALTKHQSTVPWRFTTEKSLMATPPCELTNSTLKMETPTALQQMTSNVPST
STAASQLPVETAAPEVRDSFPYLLSKDFLGQEGPGPAASEEELLPTLKPCVGDECRSLSR
GPVIATVVTVLCLLLVLVSVGAVWVYRRCQHKTSVYKLNVGQRPVRHYQQQIEMEKV
Download sequence
Identical sequences ENSCPOP00000008368 10141.ENSCPOP00000008368 ENSCPOP00000008368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]