SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008370 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008370
Domain Number 1 Region: 416-545
Classification Level Classification E-value
Superfamily C-type lectin-like 5.23e-39
Family C-type lectin domain 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008370
Domain Number - Region: 72-241
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008370   Gene: ENSCPOG00000009327   Transcript: ENSCPOT00000009412
Sequence length 550
Comment pep:novel scaffold:cavPor3:scaffold_37:17872450:17883201:1 gene:ENSCPOG00000009327 transcript:ENSCPOT00000009412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKDSEMDGGTVHFCTDEECVSLHSQGMDPVTVAPIVPKMRKLTQSAIIVIAVSVVSFLVA
VFVVGKFPDNTTEQFSEEPNRKTNLLLKKHLNNYKRNDSYFGRLQELQEAIQICKSHMDS
SSTWHVEMQMLKRRVDNVSSQIQGLEGSLGDTSADIEMVKGALQEASALGLQTQMLGGSL
EGANAEIQKLKGDLEKANALTFETQDFLKSTSKNTSVELHMLSRGLEEAQAEIQKLKESL
QNENALNAQTQTLLKGSLDNTGAEILALRGHLERTNNETHLLKRELETITAQTQLAKGHL
EQTDAQLQVLKVGLENANTLNSQIHVLSGQLEIASRQIQTLKQGMKDTAALSSQLRTLGS
NLQDASAEMRRLKGDLENIKTLTAKIQEEQSRLGTLRAAIASQEQLQKTQNQLLQLILKG
WKVFGENMYYFSQAKKTWYEAEKFCVSQGAHLTSVTSQEEQAFMVQNTGAFYHWIGLTDS
GTEGSWHWTDGTPFNKDQSKGFWDKNQPDNWLHANGETEDCVHMQKKWNDIRCQTFFHWV
CKKSKGREVA
Download sequence
Identical sequences ENSCPOP00000008370 ENSCPOP00000008370 10141.ENSCPOP00000008370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]