SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008612 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008612
Domain Number 1 Region: 13-165
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-27
Family C-type lectin domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008612   Gene: ENSCPOG00000009595   Transcript: ENSCPOT00000009682
Sequence length 166
Comment pep:novel scaffold:cavPor3:scaffold_28:4283773:4287742:-1 gene:ENSCPOG00000009595 transcript:ENSCPOT00000009682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASQITLWRIISGTFGVICLILMVTLGILLKNSKCLLMSLHNDKCQHNLFFLLVPDCCSC
QEKWIGYQCNCYFISDEKNTWTESSHFCASHNSSLLQLQNSDELAFMKSTQMFYWTGLSF
TKEHGAWLWEDGSAPSQDLLSLLPIPTPGHCVVYSPRRVADSKLCE
Download sequence
Identical sequences ENSCPOP00000008612 ENSCPOP00000008612 10141.ENSCPOP00000008612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]