SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008698 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008698
Domain Number 1 Region: 2203-2721
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.99e-98
Family Acetylcholinesterase-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 977-1073
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 3 Region: 23-92
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.58e-18
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 4 Region: 89-165
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.68e-18
Family Thyroglobulin type-1 domain 0.0022
Further Details:      
 
Domain Number 5 Region: 716-776,891-921
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.22e-17
Family Thyroglobulin type-1 domain 0.0066
Further Details:      
 
Domain Number 6 Region: 295-361
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.62e-17
Family Thyroglobulin type-1 domain 0.00088
Further Details:      
 
Domain Number 7 Region: 601-656
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000981
Family Thyroglobulin type-1 domain 0.0011
Further Details:      
 
Domain Number 8 Region: 1135-1209
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000262
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 9 Region: 662-724
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000000000379
Family Thyroglobulin type-1 domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1091-1143
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000034
Family Thyroglobulin type-1 domain 0.003
Further Details:      
 
Domain Number 11 Region: 163-195,230-248
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000445
Family Thyroglobulin type-1 domain 0.0068
Further Details:      
 
Domain Number 12 Region: 1452-1529
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000832
Family Growth factor receptor domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008698
Domain Number - Region: 1521-1556
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000296
Family Thyroglobulin type-1 domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008698   Gene: ENSCPOG00000009692   Transcript: ENSCPOT00000009779
Sequence length 2767
Comment pep:known scaffold:cavPor3:scaffold_51:3475901:3676474:-1 gene:ENSCPOG00000009692 transcript:ENSCPOT00000009779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVLWAFGLLGSACLVSANIFEYQVDAQPLRPCELQRERAFLKRMEYIPQCSEDGSFQT
IQCRNDGRSCWCVDADGREVPGSRQSRRPAACLSFCQLHRQQILLNGYLNSTATSYLPQC
QDSGDYASVQCDLWQTECWCVDTEGMEVYGTRQLGRPTRCPRSCEIRNRRILHGVGDKSP
PQCSPEGEFLPVQCKFVNTTDMMIFDLIHSYNRFPDAFVTFSSFKSRFPEVSGYCHCADS
QGRELAETGLELLLDEIYDTIFAGLDLTSTFTESTLYRILQRRFLAVQLVVSGRFRCPTK
CEVERFAAASFDHPYIPSCHRNGDYQAVQCQTQGPCWCVDAQGKEIPGTQQWAGEPPSCA
GDQSCSSERQQALSRLYFGPSGYFSQSNLFPAPEEEQASLGGTRPATACPSQIKQLFVDS
GLLHLMTKGQDPQASAFQSLLGEATRAIFPSRELARLALQFTTNPKRLQQNLFGGTFLVN
LGQFNLSGALGMRGTFNFSQFFQQLGLSGFLNRGGAVEPVKLPSVVLDVNSATKSLSMNK
TIVGSFGFQINVQENQNALKFIVSLLELPEFLLFLQRALSVPEDVARDVGDVMGMVLSSQ
ACGQSPGRLFVPSCTEEGGYEDVQCFAGDCWCVDFWGKEIPNSRVRGGQPRCPTECEKQR
ARMQSLIRNQPAGASVFVPSCSTEGHFLPVQCFNSECYCVDSEGRAIPGTQSPLGEPKQC
PSLCQLRAEQAFLGMVRTLLSNSSVPPTLSSIYIPQCSVSGQWQRVQCDGPPEQVFEWYD
RWRAQNPEAKDLSPASLLMTLISYKREASGNFHLFVQTLYEAGQQGIFPVLAPFASLQEV
PPAVLEGNLTLSTENLFLEPYFFWQMLNGQLSRYPGPYSDFSKPLAHTDLRSCWCVDAAG
QELEGTRARPNQVPACPGSCEEVKLDVLQFIKETEEIVSAFNTSRFLVGESFLIAKGIRL
TSEELRLPPHFPSQEAFFEKFLRGRDYAIRLAAQSTSNLYQRLRTSQDDWSETAVPLRSG
PYVPQCDASGNWEPRQCHMGTGYCWCMDAKGEFIPNSLTARSPQVLQCPSPCEQSRANGL
LSGWKQAGSQGDPSPEGLFIPTCLETGEFARMQVSGAGAWCVDPVSGEGMQPSTNGSTQC
PGLCSVLRNRVLSRTVSPGYTPTCGTEDGAFSLVQCDPAQGSCWCVLDSGEEVPGTHVVG
SQPACERPQCPLPFLSLSDMPGGVILCKRASGLGEATVQQCQLFCRQGYRSAFPSGLLVC
NLESKRWVSQPPQPLACQRPQLWQTVQTGAHFQILLPPGKRCSADYSGLLQAFRVFILDE
LMARGFCHVQVPTAGTLVSHPVCDNSSVQVGCLTAEHLEVNVTWKSQLKDIPAASLPDVH
DIERALVGKDLLGHFTALVQSGTFQLHLDSKTFLADTSIRFLQGDSSFGASPRTWFGCME
AFYQVLATSEASRDPLGCVMCPEGSYSLDGQCVPCPVGFYQEEAGSVACVPCPAGRTTAA
IGAFSQRHCVTDCQRNEAGLQCDQDGQYQASQKDDASGTAFCMDSEGHRLLWSQTEAPLS
DSQCLMMQKFEKAPEWKVNFSAAAPGMVRSKVPGSDSPLMQCLADCAEDQGCSFFTMFTT
ESEVACDFYNWTSDNFACTTSAQEQDALRSLQVTGFGSLMCQVKVRNRNQKSLAVYLKKG
QEFTAAGQKTFEPTGFQNTLSGLYDSVMFSASGANLTDAHLFCLLTCERDACCDGFILSQ
MPGGPLICGLLSSPDVLVCNDDDWKDSSKVQANTTCPGVTYEQGSHQVTFLLGGQEFVKS
LAPLERAPRTVIGFQQVYLWKDSDMASRPESLGCRKDVVPRSESSAETGSTAELFSPVDL
SQVIVSVNRSLPSQRHWLFKHRFSAQQAKLWCLSRCSQEPSFCQLAEVTDSAPSYFTCSL
YPDARVCDDVLEPNAQGCSLVLPQQPGTLLQKKVVLNSRVKNFYTRLPFQKLAGISIRNK
VPMSEKPISNGFFECERLCDLDLCCTGFGFLNVSQSKGGELTCLTLSSMGVQTCSEESGG
AWRILDCGSPDTEVRIYPFGWYQKPVAQSDVPSFCLPAVPPAFTKKVALDSWQSLAVSSV
AVDPSIRHFDVAHISTIATNFSAARDFCLQECSHHQACITTTLQTWPGATRCVFYPDTQS
CTHTLQGQSCQLLLREEAIHIYRKPGTTLLRSEGGSVPSVLIAPHGWLQGRSQAVQVGTA
WKQVDQFLGVPYASPPLAERRFRPPEPLNWTGSWDATKPRASCWLPGVHTPTPPGVSEDC
LYLNVFVPGNLASRAPVLVFFHNAAEEDVSKGQLAIDGSFLAAIGNLIVVTANYRTGVFG
FLRSGSSEVTGNWGLLDQVAALTWVQIHIGAFGGDPRQVSLAADRAGADVASIHLLTTRA
AGPRLFRRVLLMGGSALSPAAIISPSRAQQQTMALAEEVNCPTSSSSEVESCLRQTPANI
LNDAQTKLLAVSGPFHYWGPVVDGQYLLEDPARALRRPPLAKIDLLIGSSQDDGLINRAK
AVKRFEESQGRTESKTAFYQALQNSLGGEDSDASVLAAATWYYSLEHSQDDYASFSRALE
NATRDYFIICPTIDMARRWAKRARGNVFMYHAPESYGHGSLELLADVQYAFGLPFYPAYK
GQFSLEEKSLSLKIMQFWSNFIRSGNPNYPHEFSWKAPEFAALWPDFVPGAGGESYQEFS
SMLPIRQGLKQADCSFWSKYIQVLKTPADAALDGQSTESEDEGLLAGSELEPNFLDLPEP
GSKSYSK
Download sequence
Identical sequences XP_003467392.1.53824 ENSCPOP00000008698 10141.ENSCPOP00000008698 ENSCPOP00000008698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]