SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008808 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008808
Domain Number 1 Region: 127-283
Classification Level Classification E-value
Superfamily C-type lectin-like 1.66e-42
Family C-type lectin domain 0.000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008808   Gene: ENSCPOG00000009813   Transcript: ENSCPOT00000009901
Sequence length 292
Comment pep:known scaffold:cavPor3:scaffold_61:9432046:9434622:1 gene:ENSCPOG00000009813 transcript:ENSCPOT00000009901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEYQDLQHLDNEEKDHHQLRRGPPPPRPLCQRLCSGPCLLLLSLSLSAALLVVICVIG
SQNSQLQKELQALKETIHNFTGSTEAEVKALSSQGGGSVGKKMKLLESQLEKQQQDLRED
HSNLLFHVKQFVSSLRSLSCQMAVLQGNGSETLCCPVNWVEFHGSCYWFSKSGKPWPEAE
KYCQLENAHLVVVTSWEEQRFVQHHTGPVQTWMGLTDQDGPWKWVDGTDYETGFKNWRPL
QPDDWYGHGLGGGEDCAHFTPDGRWNDDVCQRPYRWVCETELNTTSTQPPPA
Download sequence
Identical sequences ENSCPOP00000008808 ENSCPOP00000008808 10141.ENSCPOP00000008808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]