SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008819 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008819
Domain Number 1 Region: 85-214
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-29
Family C-type lectin domain 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008819   Gene: ENSCPOG00000009825   Transcript: ENSCPOT00000009914
Sequence length 228
Comment pep:novel scaffold:cavPor3:scaffold_28:4222451:4228421:1 gene:ENSCPOG00000009825 transcript:ENSCPOT00000009914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVDIPSVLITVIQLFMIFRYTHMYTDMYAVFQERNEKEKVLEDLRKAHITQNVSSLQKLL
TNVTSEYIFKLFFENRRHGKDKIFAKPLENVGKTCEVYLTCYGVKCYYFIIDNKTWEKCK
QTCQNQGLSLLKIDDKDELGFLLSQIYPKKYWIGLFFDIREKRWKWMDAGRSSGITIAIM
NKLPTGGKCAILTPTIISSMFCDNAYSCVCEKRMDATFPASVCRKEEK
Download sequence
Identical sequences ENSCPOP00000008819 ENSCPOP00000008819 10141.ENSCPOP00000008819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]