SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008832 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008832
Domain Number 1 Region: 188-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 149-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008832
Domain Number - Region: 336-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000241
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008832   Gene: ENSCPOG00000009842   Transcript: ENSCPOT00000009931
Sequence length 544
Comment pep:known scaffold:cavPor3:scaffold_87:4208645:4247595:1 gene:ENSCPOG00000009842 transcript:ENSCPOT00000009931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARVSPTLTIPSFKTSHPPVISPNTLSNTEPLITGTVLTTSGKQHLPTHPEILVPQITTER
DITTERNQVHVDATTQLIALTSIPTSGKELSTRLGVTEESSPASPFLRTSPFSKSTDVST
AEMLTPQSTTLTAQTNTQSPTALSPVFLVNSCAVNPCLHDGKCIVDLTSRGYRCVCPPSW
QGDNCSVDVNECLLNRCPRQAICNNTQGSFICRCPVGYHLEKGICNLVRTFVTEFKLKKQ
FLNTTLEKYSDVHEVENEITKMLNVCFSTLPGYIQSTAHVSREPSVFVTSLQATFSLASS
VTLFDLNDGIQKFVNSCRSSAEVCQLLGSQARVFRAGSLCKQKSPQCDTETSICTDLDGV
ALCQCKSGYFQFNKMDHSCRACEDGYRLENETCMSCPFGLGGLNCGNPYQLITVVIAAAG
GGLLLILGIALIVTCCRKNKNDISKLIFKSGDFQMSPYAEYPKNPRSQEWGREAIEMHEN
GSTKNLLQMTDVYYSPTNVRNPELERNGLYPAYTGLPGSRHSCIFPGQYNPSFISDESRR
RDYF
Download sequence
Identical sequences 10141.ENSCPOP00000008832 ENSCPOP00000008832 ENSCPOP00000008832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]