SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008922 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008922
Domain Number 1 Region: 154-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.51e-18
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 665-733
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000565
Family VWC domain 0.007
Further Details:      
 
Domain Number 3 Region: 615-674
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000136
Family VWC domain 0.0068
Further Details:      
 
Domain Number 4 Region: 480-548
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000167
Family VWC domain 0.041
Further Details:      
 
Domain Number 5 Region: 370-428
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000178
Family VWC domain 0.014
Further Details:      
 
Domain Number 6 Region: 421-484
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000188
Family VWC domain 0.06
Further Details:      
 
Domain Number 7 Region: 554-612
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000816
Family VWC domain 0.011
Further Details:      
 
Domain Number 8 Region: 57-185
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000008
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008922   Gene: ENSCPOG00000009943   Transcript: ENSCPOT00000010033
Sequence length 879
Comment pep:known scaffold:cavPor3:scaffold_65:9873283:9888004:1 gene:ENSCPOG00000009943 transcript:ENSCPOT00000010033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARLLVGATCATLLLLLLPPEVPGRGPSGRTQPGPFANERRRLGPHVCLSVLGSGCCPG
WAPSMGSGHCTLPLCSFGCGSGVCIAPNVCSCVDGEQGATCPDAHGPCGEYGCDLTCNHG
GCQEVARVCPVGFLMTETTVGVQCTDIDECLSASCEGRCMNTEGGFVCECGPGMQLAADR
HSCQDRNECLGTPCQQKCRNSVGSYQCSCHAGFHLHRDRHSCVDVNECRRPQERRVCHHS
CHNTVGSFLCTCRPGFRLRADRTSCEAVPKVVLAPSAILQPRPPELALLLPEAGQPGLSP
AHSLGHGPISGAWTTRPPDPTMLLSTPMVTPGPLASLLGTLGPPPLPQGKALGTPFPRPD
SEDQSPAPGPSPCWHLGAFYTSGSHWAAPACKQCGCEDGVVTCGKMRCEAMCSHPAPPQD
GGCCPSCTGCFYGGTVWMEGDVFSPPGENCTVCVCLAGNVSCISPECPPGPCEAAPKPDC
CACAPVRCHFRGRWYVEGAVFSGAGDDCTTCVCQHGEVTCSFTPCPELDCPREEWHLGPG
QCCFTCREPTPHSGCSLDDSGAEFPVGQVWSPGDPCELCICQADGSVSCRRTDCVDSCPH
PIRIPGQCCPDCSAGCTYTGRVFYNNETFPSALDPCLSCICLLGSVACSPVDCPIACTYP
FHPDGECCPVCHDCNYEGRKVANGQVFVLDDEPCTRCTCQLGEVSCERVPCPLVCTDAAP
HVPAGDCCAPCSGSLRPLDDKPGLLAPRDAEVLVPCRTCPRPPTAPPPQPVLQLHRQLSG
ANASGMLPEPAPRWGAGVLVPRRPGSFQVPPRSSLPPASLERPLPTLGAQLLTIQVPSPT
KTPATLLQPQGLSAASEATRHPGPQQPSMGMPRKEEPLL
Download sequence
Identical sequences 10141.ENSCPOP00000008922 ENSCPOP00000008922 XP_003465929.1.53824 ENSCPOP00000008922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]