SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009033 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009033
Domain Number 1 Region: 658-937
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-84
Family Protein kinases, catalytic subunit 0.000000000755
Further Details:      
 
Domain Number 2 Region: 48-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-70
Family Ephrin receptor ligand binding domain 0.0000016
Further Details:      
 
Domain Number 3 Region: 345-548
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-39
Family Fibronectin type III 0.000084
Further Details:      
 
Domain Number 4 Region: 956-1021
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-21
Family SAM (sterile alpha motif) domain 0.00052
Further Details:      
 
Domain Number 5 Region: 270-347,383-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000454
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009033   Gene: ENSCPOG00000010060   Transcript: ENSCPOT00000010151
Sequence length 1026
Comment pep:known scaffold:cavPor3:scaffold_94:2418702:2752506:-1 gene:ENSCPOG00000010060 transcript:ENSCPOT00000010151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGAGLRRPTARTPASPAGCCCAPRRAPLWTCLVLCAALRTLLASPSSEVNLLDSRTVMGD
LGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKF
TLRDCNSLPGGLGTCKETFNMYYFESDDANGRNIKENQYIKIDTIAADESFTELDLGDRV
MKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSIVRHLAVFPDTITGADS
SQLLEVSGACVNHSVTDEPPKMHCSAEGEWLVPIGKCMCQAGYEEKNGTCQVCAPGFFKA
SPHSQTCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSAPRNAISNVNETS
VFLEWIPPADTGGRRDVSYYIACKKCNSHAGVCEECGGHVRYLPQQIGLKNTSVMMADLL
AHTNYTFEIEAVNGVSDLSPGTRQFVSVNVTTNQAAPSPVTNVKKGKIAKNSISLSWQEP
DRPNGIILEYEIKYFEKDQETSYTIIKSKGTTITAEGLKPASVYVFQIRARTAAGYGVFS
RRFEFETIPVSVAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGSCCECGCGRASSLCA
VAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIE
ASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRDFLGEASIMGQF
DHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIAAGMKYL
SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDAEAAYTTRGGKIPIRWTAPEAIA
FRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLM
LDCWQKDRNSRPKFEEIVNMLDKLIRNPSSLKTLVNASSRVSSLLAEHGSLGSGAYRSVG
EWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLA
NGMVPL
Download sequence
Identical sequences ENSCPOP00000009033 10141.ENSCPOP00000009033 ENSCPOP00000009033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]