SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009044 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009044
Domain Number 1 Region: 185-266
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.4e-25
Family Thyroglobulin type-1 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.96e-23
Family Growth factor receptor domain 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009044   Gene: ENSCPOG00000010072   Transcript: ENSCPOT00000010163
Sequence length 272
Comment pep:known scaffold:cavPor3:scaffold_153:1631578:1645505:1 gene:ENSCPOG00000010072 transcript:ENSCPOT00000010163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMVLTTVLLLLAAYAGPAQGLGSLVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQTCGVYTERCALGLRCLPRQGEEKPLHALLHGRGVCLNEKNYREQAKIEKDSSEHE
EPTTSEVTEETYAPKIFRPKHTRLSELKAEAVKKDRRKKLTQSKFVGGTENTAHPRVTSA
SEMRQESEQGPCRRHVEASLQEFKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Download sequence
Identical sequences ENSCPOP00000009044 10141.ENSCPOP00000009044 ENSCPOP00000009044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]