SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009528 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009528
Domain Number 1 Region: 1520-1633
Classification Level Classification E-value
Superfamily C-type lectin-like 3.53e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000534
Further Details:      
 
Domain Number 2 Region: 1444-1519
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-25
Family Noncollagenous (NC1) domain of collagen IV 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009528   Gene: ENSCPOG00000010611   Transcript: ENSCPOT00000010708
Sequence length 1634
Comment pep:novel scaffold:cavPor3:scaffold_5:15819012:15860982:-1 gene:ENSCPOG00000010611 transcript:ENSCPOT00000010708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGQPGPVGPQGFSGPPGLQGFPGLQGRKGDKGERGAPGTPGPKGDVGPRGVSGFPGADGI
PGHPGQGGPRGRPGYDGCNGTRGDTGPQGPSGSGGFPGAPGPQGPKGQKGEPYALPKEER
DRYRGETGEPGLIGPKGFPGHPGPMGPMGPVGAPGRPGPPGPPGPKGQPGNRGLGFYGEK
GEKGDQGLPGPNGIPSDTLHPIVAPTGTTLHPSMYKGEKGTQGEPGPQGISYKGEEGIMG
FPGTRGPPGLDGEKGFPGQKGSRGLDGYQGPHGAPGQKGEQGEPGPPGSLAYSPHPALAK
GIRGDPGFPGGYGEPGSRGPPGDPGPPGPPGLPAGDQGERRGLPGEMGPKGFTGEPGFPA
RVWGPPGADGIPGQQGPPGPPGPPGPDGFLFGLKGAQGSRGYEGHAGYPGMRGQKGRKGD
AGDCKCAAGDQFISLPGLPGLKGFPGANGEPGRKGEPGDPGPHGIPGFPGFKGSPGSVGA
PGPKGAKGDARTVTTKGEKGQPGIPGMPGLKGDDGIPGRDGLDGFPGLPGPPGDGIKGPP
GDAGYPGAPGTKGLPGEMGPPGLGLPGRKGQQGFPGDAGFPGPQGFQGPPGPPGSPGDTD
CDTGVKRPIGGDGQESVQPAGCVGGPRGSPGLPGPPGAPGDKGARGIPGFTGQDGPQGLK
GIPGDPGRQGSPGPPGFIGPRGSKGAVGLPGPEGLQGPNGLPGPAGPPGDRGIPGEVLGA
QPGPRGDAGLPGYPGLKGAPGERGPPGFRGSQGMPGMPGLKGQVGFPGPSGQPGLPGPPG
QHGFPGAPGPEGPLGLPGTPGREGLPGDRGDRGDTGAPGPVGMKGRGQPGTPGFKGMSGM
PGSPGPKGDRGSPGMEGFQGMVGLKGRPGLPGTKGEAGLFGLPGVRGPPGQPGGKGTRGD
PGPPGPPPVILPGMKHIKGEKGEQGTLGLPVGVQGMPGIPGQAGIPGLPGRPGHIKGIKG
DIGLPGSPGQPGFPGVVGPPGIIGFPGFTGSRGDKGAPGRIGLFGEVGQPGDLGDTGDTI
NLPGSPGLKGERGAIGTPGLKGFFGERGAQGEVGFPGITGLAGPQGPPGLKGQPGFPGLT
GVQGPQGDPGRIGFPGEKGDDGWPGIPGLPGFPGQRGISGLHGLPGPKGSPGSPGADMPG
DPGFPGPAGDRGDPGEPNTFPGPTGVPGQKGAQGAPGDRGPAGRPGMQGFPGISPSSNIS
GLPGDAGSPGIFGLKGYPGPQGPPGPAALPGSKGDTGNAGAPGVPGPKGWAGDLGPQGRP
GVFGVPGEKGPRGEPGLMGSIGPTGAVGDRGPKGPKGDQGFPAGAPGSVGSPGIAGIPQR
ILAPAGAMGPQGRRGPPGAQGEMGPQGPPGEPGFRGAPGKPGLQGRGGVSALPGFRGDPG
PVGHQGPIGQEGSCARGGGPGFLLFPGCPVECGVRVIGLRVSKEQAHRPQGRPQTWTVWD
PRRRAGSGHKQEMRLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPV
AEEDIRPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQ
SLVSPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTIPEASFQGSPSADTLKAGLI
RTHISRCQVCMKNL
Download sequence
Identical sequences ENSCPOP00000009528 10141.ENSCPOP00000009528 ENSCPOP00000009528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]