SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009739 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009739
Domain Number 1 Region: 597-897
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-81
Family Protein kinases, catalytic subunit 0.0000000001
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-77
Family Ephrin receptor ligand binding domain 0.0000000122
Further Details:      
 
Domain Number 3 Region: 312-510
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-27
Family Fibronectin type III 0.00023
Further Details:      
 
Domain Number 4 Region: 893-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.09e-21
Family SAM (sterile alpha motif) domain 0.0000301
Further Details:      
 
Domain Number 5 Region: 233-304,343-362
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000903
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009739   Gene: ENSCPOG00000010844   Transcript: ENSCPOT00000010943
Sequence length 969
Comment pep:novel scaffold:cavPor3:scaffold_25:12487370:12593988:-1 gene:ENSCPOG00000010844 transcript:ENSCPOT00000010943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRR
RGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYESDFDSATKTFPNWMENPWVKVDT
IAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRV
IQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGF
EAVENGTVCRGCPSGTFKPNQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMP
CTRLLPLLSQAVISSVNETSLVLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNV
QYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSPH
MLLVKPSRAPSTLAHEWCFQPKEGGQVLSSHLRYLEKELSEYNATAIKSPTNTVTVQGLK
AGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVV
VIAIVCNRRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDI
SCVKIEQVIGAVGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQF
DHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYL
ADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEA
IQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQ
LMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNT
VDEWLEAIKMGQYKESFASAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQ
MNQIQSVEV
Download sequence
Identical sequences 10141.ENSCPOP00000009739 ENSCPOP00000009739 ENSCPOP00000009739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]