SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009887 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009887
Domain Number 1 Region: 165-285
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-30
Family C-type lectin domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009887   Gene: ENSCPOG00000010999   Transcript: ENSCPOT00000011100
Sequence length 288
Comment pep:known scaffold:cavPor3:scaffold_75:5634216:5643219:-1 gene:ENSCPOG00000010999 transcript:ENSCPOT00000011100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPITLPRPGVNVLPVPTMSRDLALMSVLLGLACLLLLPPARPQPAAEDACSVQILVPGLK
GDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGAKGDKGEVGDIGPP
GPHGEPGLPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGVRETDSKIYLLVKEEKRY
ADAQLSCQGRGGTLGMPKDEAANGLMAAYLAQAGLARVFIGINDMEREGAFVYSDRSPMQ
TFSKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFLCEFDKESV
Download sequence
Identical sequences 10141.ENSCPOP00000009887 ENSCPOP00000009887 ENSCPOP00000009887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]