SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009925 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009925
Domain Number 1 Region: 320-397
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.19e-21
Family Intermediate filament protein, coiled coil region 0.00061
Further Details:      
 
Domain Number 2 Region: 110-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000068
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009925
Domain Number - Region: 148-218
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00068
Family Intermediate filament protein, coiled coil region 0.0086
Further Details:      
 
Domain Number - Region: 9-58,93-106,407-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0738
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009925   Gene: ENSCPOG00000011043   Transcript: ENSCPOT00000011145
Sequence length 475
Comment pep:novel scaffold:cavPor3:scaffold_9:47510680:47517366:-1 gene:ENSCPOG00000011043 transcript:ENSCPOT00000011145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTKSIMTCGSYCGGRAFSCASACGPRPGRCCITAAPYRGISCYRGLTGGFGSRSVCGAFH
TGAYGRSFGYRSGGVCGPSPPCITSVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNS
RFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYVQTLRREAECVEADGGR
LAAELNHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRRSDLEANVEALTQE
IDFLRRLYEEVRGSQPWVWPHMTLVGVTGQDCPVWLYRLSTVESKCEEIKATVIRHGETL
RRTREEINELNRIIQRLTAEIENAKCQNTKLETAVTESEQQGEATLNDAKCKLAGLEEAL
QKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEGIGSVNVCVSSSRGGI
VCGDLCATGTSPAVNTRVCSAPCSGNVVVGTPNACAPCAGVSAYSSGCKQCLCFA
Download sequence
Identical sequences ENSCPOP00000009925 10141.ENSCPOP00000009925 ENSCPOP00000009925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]