SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010019 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010019
Domain Number 1 Region: 335-455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.1e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 207-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 161-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000479
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010019
Domain Number - Region: 805-948
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00141
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number - Region: 126-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00302
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 707-834
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0132
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number - Region: 1047-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0183
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 655-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family Laminin-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010019   Gene: ENSCPOG00000011143   Transcript: ENSCPOT00000011247
Sequence length 1571
Comment pep:novel scaffold:cavPor3:scaffold_25:27923795:27991649:1 gene:ENSCPOG00000011143 transcript:ENSCPOT00000011247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPLQRRDRASWSSRSLLLLGVPALQGLGSPCSPQPAQSSRPHVCAEQELTLVGRRQPCVQ
AFSRVVPVWEPGCGQQVWCLGHQRRTIYYTGFRQVYAVEARTVLRCCSGWSRLPGREGCL
SAPTECQSVNSHCRGGCCRPRVGFSCHCLRGHWLPGDGNTYPDVDECLAHNGGCQHRCVN
TPGSYFCACKPGFRLHSDGRTCLAVNSCALGNGGCQHQCLQLTTTRHRCQCHPGFQLQED
GRRCVRRSPCAEGNGGCMHTCQELQGLAQCGCHAGFQLAADRKACEDVDECAPGLARCAH
GCLNTQGSFKCVCRAGYELGADGRQCYRIEMEIVNSCEVGNGGCSHGCRHSSGGPLCTCP
RGYELDQDQRTCVDVDDCADAPCCQQVCTNTPGGYECGCYAGYRLSADGCGCEDVDECAS
GRSGCEHRCTNLAGSFQCSCEAGYRLDEDRRGCTSLEEPAVDLDGQLPFERPLPHIAVLR
DELPRLFQEDSGAEEEEAELRGELTLAEKYVCLDNSFGPDCSLTCDDCRNGGTCLPGLDG
CHCPKGWTGLICNETCPPDFFGKNCSSPCSCQNGGTCDPVTGACRCPPGVSGAHCEDGCP
KGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEECRCEQP
HTQSCDRRDGSCLCKAGFRGERCQAECEPGFFGPGCRQACTCPPGVACDPASGECWQQCP
PGYHGQDCGQECPAGTFGVNCSGSCSCGGAPCHRVTGQCLCPPGKTGEDCGEDCPEGHWG
LGCQEICRPCEHGGRCEPETGACLCLPGFIGSRCQDACPAGWFGPGCQMRCSCANDGHCH
PATGRCSCAPGWTGLSCQRACDSGHWGPDCSHPCNCSAGRGSCDAASGRCLCEAGYMGPQ
CEQECPQGYFGPSCGQRCRCEHGAACDHISGACTCPPGWRGTFCERTCPAGFFGVDCHSA
CDCSAGATCDTVTGSCVCPAGRQGPRCAQTCPALTYGLNCSQACTCSNGASCDPVHGQCH
CAPGWMGPACLQACPAGQYGQDCQHSCLCRNGGSCDPVTGRCTCPEGWTGLACEDECRPG
HYGAGCLLSCRCLHGGLCDRHTGHCLCPAGWTGDMCQSPCAPGTFGPRCEEHCACRQGAT
CHHVTGACLCPPGWRGSQCEEACQRGWFGDACAQRCRCPPGNPCHHVTGECRCPSGLTGP
GCEQACPPGTFGESCGQLCRCPGHNWVCHPATGACTCAAGYHGPSCQQRCPSGRYGPGCE
QLCGCLNGGSCDGVTGACHCPAGFLGADCSLSCPQGRFGPDCAHVCRCGQGATCDSVTGT
CACPPGRTGVHCEHGCAPGWFGSGCERQCTCRNGGLCHAATGSCSCGLGWMGPHCEQACP
QGHYGAACRLACSCHNNGTCEPTTGTCRCGPGFYGPACEHSCPPGFHGMGCKQACECQQG
APCDPVSGQCLCPTGFQGQLCEEGCEPGSFGEGCRQRCDCGDGVPCDPISGLCLCPPGRS
GATCELTCRGSHFGPGCALRCDCEGGADCDPVSGQCHCVDGYMGPTCRAGPGTQPASSTT
VPRLSSRAAKH
Download sequence
Identical sequences 10141.ENSCPOP00000010019 ENSCPOP00000010019 ENSCPOP00000010019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]