SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010099 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010099
Domain Number 1 Region: 180-473
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-81
Family Protein kinases, catalytic subunit 0.000000000493
Further Details:      
 
Domain Number 2 Region: 11-98
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000985
Family Growth factor receptor domain 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010099   Gene: ENSCPOG00000011232   Transcript: ENSCPOT00000011338
Sequence length 773
Comment pep:known scaffold:cavPor3:scaffold_13:44111039:44353842:-1 gene:ENSCPOG00000011232 transcript:ENSCPOT00000011338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCCFHSEFREFENGSVCVECDPQCEKVEEGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPD
GLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTIHDCIYYPWTGHSTLPQHARTPLIAA
GVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKE
TELKRIKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASM
DHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLE
ERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYR
KFTHQSDVWSCGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVK
CWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLED
MMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQ
GMPVPYRATTSTIPEAPAAQGATAEIFDDSCCNGTLRKPVAPHSQEDSSTQRYSADPTVF
ASERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGNPQALDNPEYHKAANGP
PKTEDEYVNEPLYLNTFANALGKAEYLKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQH
PDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
Download sequence
Identical sequences 10141.ENSCPOP00000010099 ENSCPOP00000010099 ENSCPOP00000010099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]