SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010130 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010130
Domain Number 1 Region: 2004-2173
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 2 Region: 1735-1847
Classification Level Classification E-value
Superfamily CalX-like 1.7e-20
Family CalX-beta domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010130
Domain Number - Region: 387-422
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0196
Family Purple acid phosphatase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010130   Gene: ENSCPOG00000011267   Transcript: ENSCPOT00000011373
Sequence length 2174
Comment pep:known scaffold:cavPor3:scaffold_21:5876200:5994467:1 gene:ENSCPOG00000011267 transcript:ENSCPOT00000011373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALLLLLLLLLLDGAAPTLISVNRGLRVMKGSSAFLSAEDLKFAIPREKDVCKVEVVMHE
PITQRVGKLTPQVFDCHFLPNEVRYTHNGCPILHEDTVKLRLYRFTETDTFTETFLLRVY
LLEPDCHIIQMRSHVLEVSEFYGLSRAIDKNLLQFDYDRTAGLECTVKLDPVRTHLPARG
QMVVVEPRPEGPRGDQPHSFFPESQLGTELKCPDRSCTLGLKKIESLKVSCEEFLLMGLR
YQHMQPPSPNIDYISIQLDLTDSRSKILYKKSESVWLPVYIRAGIPNQIPRAAFMAMFIL
EVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLMDHTQPISSFTWKDLSN
MQIAYQPPNNSHSERRHYEVELELYDFFFAKSAPITVHISIRTADTNAPRVSWNTGLNLL
EGQSRAITWEQFQIVDNDNIDAVQLVTVDGLQHGRLTVRGGKGFLFTVSDLQAGAVRYHH
DDSDSTKDFVVFRIFDGYHSIRHKFPINILPKDDSPPFLITNVVIELEEGQTISIQGSML
RASDMDSSDDYIFFNITKPPRAGEIMKKPGPGLIGYPVPGFLQRDLLNGIIYYRHFGGEI
FEDSFEFVMQDSHEPPNLSEPQVVMIQVTPVDDQLPQEAPGVSRHLIVKETEVAYITKKH
LHFLDTESHDGELLYTITTPPFFSFRHRHLDAGKLFMVDSIPKLAKNPTALGLKSFTQHA
VNYLKVAYMPPLEDIGPHPRQVQFTFSISNQHGGTLHGICFNITILPVDNQVPKVLTNHL
RVAEGDQCIISTEHILISDVDTTLDNIHLSLQGVPLHGRLELNGFPLNTEDTFSWEDLHT
LKVRYRHDGSEILQDDICLKVTDGTNWTEFVLHVEVLPVNDEPPVLKTGLIPIMHCSEGG
EVIITQEYILATDMDSDDLKLMFLIAREPQHGVVRKAGVKVDHFSQGDVISGAVTYKHTG
GEVGLVPCLDTITLVVSDQEAGPFVNGCCYNGTNPSAPLHESFPVYDLNITIHPVDNQPP
SIAIGSTFVVDEGSSATLTINHLSATDPDTAADDLEFVLISPPQFGYLENTLPSVGFEKS
NTGISIASFQWKDLKALHINYVQSRHLRIEPTADQFVVHVTDGKRCSREALLYVVINPTN
DEVPDFVVQNISVCEGQMMELDSSIIRAADLDIPKDFLLFSILHKPRHGFLVDRVNSKDS
LQNKQLASPDQKHEVVHNFSMDLFKSGLRLTYVHDDSESLADDFSIQLSDGKHEILRTIS
VEVTPVNDEKPTLSKKAEIAVNMGDTRILSSAVLSAVDKDTPREKICYLFERFPQNGQLQ
LKIGRDWAPLSPGMRCTQEDVDLNLLRYTHTGALDSQNQDSFTFYLWDGDNRSPAFDCHI
VIKDMGKGDFVIIAKPLVVSKGDRGILTTTTLLAVDGANKPEELLYVITSPPQYGQVEYV
HYPGVSITSFSQMDIAGQTVCYAHKSKVASPSDSFRFLVSNGLWTKHGVFEITLKAEDRA
LPMVTKNKGLRLAKGAVGVLSPELLELTDPDTPAENLTFLLARLPQHGQLYLRGAVLLQQ
SFTQRDVDSRNVAYQHTGGDSQVDYFTFVATDRTNQGFVVDGRVWKDPVPFTIQVDQLDK
TAPRITRLHSASQVGLLKNGCYGIYITSHVLKASDPDTKDDEIIFKILRGPLHGHLENTT
TGEFICEQFSQKDLNSKTILYIINPSLEVNSDIVEFQIMDPTGNSATPQILELKWSHIEW
SQTEYEVCENVGMLPLEVTRRGHTMDSAFVGIKVNQVSATVGKDFTVTPSKLIQFDAGMS
TKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSYSFSQSK
HHAWEKGIWHPLSPGSSSPTTSGSLHLERRPLPSSKQLLLTRGDTLGGFDSTALSQRKLR
TRGNGKVVRPSSVYRNGTDIIYSYHGMVSLKLEGDSFPSHKRKTKVAIISEPEKTIQVTE
LPQADKVESTTDSHFPRQGQSPSFPKNCTVDLKGLFHFEESIQKLYQCDGIAWKAWNSKT
KEVGDKSCPAGWHLHAGYCHTLITEQKSTWNMATQTCREQYLGNLVTVFSRHHMQWLWDF
GRRKPFWIGLNDQEHAGLWEWTGGEPVTFTTWKRGPPQHSKFGRNCVLVQRQGRWQTKNC
SRGKAHNFVCSRKL
Download sequence
Identical sequences 10141.ENSCPOP00000010130 ENSCPOP00000010130 ENSCPOP00000010130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]