SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010191 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010191
Domain Number 1 Region: 2-419
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.51e-113
Family L-arabinose binding protein-like 0.000012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010191
Domain Number - Region: 428-489
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0502
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010191   Gene: ENSCPOG00000011335   Transcript: ENSCPOT00000011441
Sequence length 774
Comment pep:novel scaffold:cavPor3:scaffold_8:53252720:53267690:1 gene:ENSCPOG00000011335 transcript:ENSCPOT00000011441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNFRGFRWMKAMIHTIKEINERKDILPNTTLGYQIFDTCFTISKAMESALVFLTGQEENK
PNIRNSTGAYLAGIVGSGGSSLSIAASRILGLYYLPQVGYFSTCSILSDKFQFPSYIRTI
ASDKFQSEAMVRLIQHFGWVWVGTIAADDDYGKYGVKAFKEQMESANLCIAFSETIPKVY
SNEKMQKAVKAIRSSTARVIVLYASDIDLSPFVLEMVYHNITDRTWIASEAWITSALIAK
PEYFPYFGGSIGFAIPRTDIPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNISVPY
NVDHRDVSQLRITNNVKQAVYAMAYALDQLSRCEEENTCAYLPDFEPWQLMYYVKTLKFN
THDGKKIEIDQNGDVFGYYDILNWQLDDNGEIAFVKVGEYKFAPDKYELVFKKNSTIFWN
TESSRLPHSVCTDVCPPGTRKGIRQGEPICCFDCIPCADGHVSERAGQRECDQCGEDYWS
NEQKSMCVLKEVEFLAYDEALGFTLVILSIFGALVILAVMIVYVIYRQTPLVNANDRELS
FLIQVSLIITVLSSMLFIGKPYNWSCMARQVTLALGFSLCLSSTLGKTISLFFAYRISIS
KTRFISMRPIFRKIIVLISILVEIGICIAYLILQPPRVYKNMESQNIKIILECNEGSIEF
LCSMFGIDAFLALLCFLTTFVARQLPDNYYEGKCITFGMLVLFIVWISFVPAYLSTKGKF
KVAVEIFAILASSYGLLGCIFAPKCFIILLRPKRNTDETVGGRVPAVDRSIQLT
Download sequence
Identical sequences ENSCPOP00000010191 10141.ENSCPOP00000010191 ENSCPOP00000010191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]