SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010233 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010233
Domain Number 1 Region: 391-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000119
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 327-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000215
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 286-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000378
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010233
Domain Number - Region: 49-76,174-214
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0118
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number - Region: 254-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0258
Family EGF-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010233   Gene: ENSCPOG00000011383   Transcript: ENSCPOT00000011489
Sequence length 667
Comment pep:known scaffold:cavPor3:scaffold_10:26587839:26595140:1 gene:ENSCPOG00000011383 transcript:ENSCPOT00000011489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARSSSGWTLLLLVALWQQRAAGSGVFQLQLQEFANERGVLASGRPCELGCRTFFRV
CLKHFQKVVSSGPCTFGSVSTPVLGTNSFAIGDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKITIQGSLPVGQNWLPEEQTSTLTRLRYSYRVICSDNYY
GDSCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGEYCEQRWPGLLSGCHEQNGYCSKPAE
CLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCNEGWGGLFCDQDLNYCTHHTPCKNGA
TCSNSGQRSYTCTCRPGYTGIDCELELSKCDSNPCRNGGSCKDQEDGYHCLCPPGYYGLH
CEHSTLTCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTNNPCANGGQCL
NRGPSRTCRCRPGFTGTLCELHISDCTRNPCAHGGTCHDLENGIVCTCPVGFSGMRCEVR
MSSDACASGPCFNGATCYTGLSPDNFVCNCPYGFVGSRCEFPVGLPPSMVAVAVRQLRLR
RPDDGRREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKQQNHTLDYNLT
PGPLGQGTLLGKYPHTDKSLGEKVPLRLHSEKPECRISAICSPRESMYQSVCLISEERNE
CVIATEV
Download sequence
Identical sequences 10141.ENSCPOP00000010233 ENSCPOP00000010233 ENSCPOP00000010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]