SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010502 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010502
Domain Number 1 Region: 473-652
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.14e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 72-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.66e-36
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 278-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-35
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 4 Region: 678-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 5-48
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000662
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010502   Gene: ENSCPOG00000011676   Transcript: ENSCPOT00000011789
Sequence length 714
Comment pep:novel scaffold:cavPor3:scaffold_20:22417107:22741016:1 gene:ENSCPOG00000011676 transcript:ENSCPOT00000011789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKIY
GEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQE
RKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGRS
GTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRD
LFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNALCKDGWNRFICDCTGTG
YWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSADT
LRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKSLKLTVD
DDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGLLYIDLCKNGD
IDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSADGFILFNSG
DGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKVDT
KVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRLPDLIN
DALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCND
Download sequence
Identical sequences 10141.ENSCPOP00000010502 ENSCPOP00000010502 ENSCPOP00000010502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]