SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010506 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010506
Domain Number 1 Region: 158-263
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-39
Family Link domain 0.0069
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-23
Family Link domain 0.0028
Further Details:      
 
Domain Number 3 Region: 48-155
Classification Level Classification E-value
Superfamily Immunoglobulin 7.37e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010506   Gene: ENSCPOG00000011680   Transcript: ENSCPOT00000011793
Sequence length 354
Comment pep:known scaffold:cavPor3:scaffold_1:20480796:20507546:1 gene:ENSCPOG00000011680 transcript:ENSCPOT00000011793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLLLLVLVSVCWADHHLDNYTLNQDRVIHIQAENGPRLLVQAEQAKVFSHRGGNVTLP
CKFYRNPSAFASGLHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDN
DASLVITDLSLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYSPRLGRYNLNFHEAQQA
CLEQDAMIASFDQLYEAWRSGLDWCNAGWLSDGSVQYPITRPREPCGGQNTVPGVRNYGF
WDKEKSRYDVFCFTSNFNGRFYYLIYPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences A0A286Y2D1
XP_005008079.1.53824 XP_012999125.1.53824 10141.ENSCPOP00000010506 ENSCPOP00000010506 ENSCPOP00000010506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]