SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010602 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010602
Domain Number 1 Region: 160-366
Classification Level Classification E-value
Superfamily L domain-like 1.11e-41
Family Ngr ectodomain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 1031-1221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-38
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 393-587
Classification Level Classification E-value
Superfamily L domain-like 1.87e-35
Family Ngr ectodomain-like 0.00023
Further Details:      
 
Domain Number 4 Region: 639-773
Classification Level Classification E-value
Superfamily L domain-like 3.11e-35
Family Ngr ectodomain-like 0.006
Further Details:      
 
Domain Number 5 Region: 21-129
Classification Level Classification E-value
Superfamily L domain-like 1.7e-26
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 6 Region: 802-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000021
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 963-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000914
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 845-889
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.007
Further Details:      
 
Domain Number 9 Region: 882-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000524
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 932-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 1217-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000547
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010602
Domain Number - Region: 1260-1297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000357
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1302-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000379
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010602   Gene: ENSCPOG00000011787   Transcript: ENSCPOT00000011902
Sequence length 1418
Comment pep:novel scaffold:cavPor3:scaffold_73:4538371:4680377:1 gene:ENSCPOG00000011787 transcript:ENSCPOT00000011902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKVFPSILHFSVTVAKINLNDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFR
ALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGL
YTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLT
EIPTNLPETITEIRLEQNSIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNS
LVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIA
KGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIK
SKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIP
QYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSN
RLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGLSSVRLLSLYDNQITTIAPGAFDT
LHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPQDVAIQDFTCD
DGNDDNSCSPHSRCPAECTCLDTVVRCSNKGLRVLPKGIPRDVTELYLDGNQFTLVPKEL
SNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLH
GNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMA
DKLLLTTPSKKFLCQGPVDVNILAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQD
CDIPIHACISNPCKHGGTCHLKEGERDGFWCICADGFEGENCEVNVDDCEDNDCENNSTC
VDGINNYTCLCPPEYTADICCERVGFFTFSCSPCQHEAHIVLLSHTFRCDCTPGYIGEHC
DIDFDDCQDNKCKNSAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNG
AQCIIRINEPVCQCLPGYQGEKCEKLVSVNFVNKESYLQIPSTKVQPQTNITLQQIATDE
DSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSL
SLSVDGGSPKIITNLSKQSTLNFDSPLYVGGMPGKNNVASLRQAPGKNGTSFHGCIRNLY
INSELQDFRKVPMQTGILPGCEPCHKKVCAHGTCQPGRQSGFTCECEEGWMGPLCDQRTN
DPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQTIKCKHGKCRLSGLG
QPYCECSSGYTGGSCDRAEISCQGERIRDYFQKQQGYAACQTTKKVSRLECKGGCAGGQC
CGPLRSKRRKYSFKCTDGSSFADEVEKVVKCGCTRCAS
Download sequence
Identical sequences ENSCPOP00000010602 ENSCPOP00000010602 10141.ENSCPOP00000010602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]