SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010723 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010723
Domain Number 1 Region: 1025-1074,1102-1153
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000626
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number 2 Region: 468-507,611-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000926
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010723   Gene: ENSCPOG00000011919   Transcript: ENSCPOT00000012034
Sequence length 1224
Comment pep:known scaffold:cavPor3:scaffold_12:7257349:7538018:1 gene:ENSCPOG00000011919 transcript:ENSCPOT00000012034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGLCALLACCWGPAAVLATAGGDVDASKELECKLKSITVSALPFLRENDLSIMHSPS
ASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLF
HIHHQDGAPSLPGQDPTEEPQHESAEEELRILHISVMGGMIALLLSILCLVMILYTRRRW
CKRRRVPQPQKSASAEAANEIHYIPSVLIGGHGRESLRNARVQGHNSSGTLSIRETPILD
GYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKAGMDLTPGSDNAKLSLMNK
YKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSSTEAENDPQLT
FYTDPSRSRRRSRVGSPRSPVNKTTLTLISITSCVIGLVCTSHVNCPLVVKITLHVPEHL
IADGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETG
RQEHRAAGECLCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIF
RFTYTLGEGMWLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLE
VLLDSFGPVRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSGCYDRHIGVDC
SDGFNGGCEQLCLQQMAPFPDDPALYNILMFCGCIEDYKLGVDGRSCQPITETCPEGGDC
GESRELPMNQTLFGEMFFGYNNQSKEVAPGQVLKGTFRQNNFARGLDQQLPDGLVVATVP
LENQCLEEVSEPTPDPDFLTGMVNFSEVSGYPVLQHWKVQSVMYHIKLNQAAVSQAFSNA
LHSLDGATSRADFVALLDQFGNHYIQEAIYGFEESCSIWYPNKQVQRRLWMEYEDISKGN
SPSDESEERERDPKVLTFPEYIASLSDSGTKRMAAGVRMECQSKGRCPSSCPLCHVTSSP
DTPAEPVLLEVTRAAPIYELVTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGA
DGLPTCAPLPQPVLRLSTVHEPSSTLVVLEWEHSEPPIGVQIVDYLIRQEKVTDRMDHSK
VETETVLSFVDDIISGAKSPCAMPSQVPDKQLTTISLIVRCLEPDTIYMFTLWGVDNTGR
RSRPSDVIVKTPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVL
YHYNQHYESFGEFTWRCEDELGPR
Download sequence
Identical sequences ENSCPOP00000010723 ENSCPOP00000010723 10141.ENSCPOP00000010723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]