SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010734 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000010734
Domain Number - Region: 429-496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010734   Gene: ENSCPOG00000011932   Transcript: ENSCPOT00000012047
Sequence length 785
Comment pep:known scaffold:cavPor3:scaffold_12:7157340:7201540:-1 gene:ENSCPOG00000011932 transcript:ENSCPOT00000012047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWQCGTWLRGLQLAAAPWAALLALALPGWVLAVSATVAAAVVPEQHASSAGQPPLDWLL
TDRGPFHRAQEYADFMERYRQGFTTRYRIYREFARWKVNSLALERKDFFSLPLPLAPEFV
RNIRLLGRRPNLQQVTENLIKKYGTHFLLSATLGGEESLTIFVDKRKLGRKTESTGGGPA
VGGSGNSSAVSLETLHQLAASYFIDRESTLRRLHHIQIATGAIKSVTSERAGPLGCSNYD
NLDSVSSVLVQSPENKVQLLGLQVLLPEYLRERFVAAALSYITCSSEGELVCKQNDCWCK
CSPTFPECNCPDADIQAMEDSLVQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAI
SQFWAMDAGLQHRYQQLGASLKILFKKTHRIVRRLFNLCKRCHRQPRFRLPKERSLSYWW
NRIQSLLYCGESTFTGTFLEQSHSCTCPYDQSSCQGLIPCALGEGPACAHCAPDNSTRCG
SCNPGYVLAQGLCRPEVAESLENFLGLETDLQDLELKYLLQKRDSRIEVHSIFISNDMRL
GSWFDPSWRKRMLLTLKSNKYKPGLVHVMLALSLQICLTKNSTLEPVMAIYVNPFGGSHS
ESWFMPVNEGNFPDWERTTVDAAAQCQNWTITLGNRWKTFFETVHVYLRSRIKSLDDSSN
ETIYYEPLEMTDPSKNLGYMKINTLQVFGYSLPFDPDAIRDLILQLDYPYTQGSQDSALL
QLIELRDRVNQLSPPGKVRLDLFSCLLRHRLKLANNEVGRIQSSLRAFNLKLPNPVEYET
GKLCS
Download sequence
Identical sequences 10141.ENSCPOP00000010734 ENSCPOP00000010734 ENSCPOP00000010734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]