SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010747 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010747
Domain Number 1 Region: 108-246
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-35
Family C-type lectin domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010747   Gene: ENSCPOG00000011944   Transcript: ENSCPOT00000012060
Sequence length 249
Comment pep:known scaffold:cavPor3:scaffold_28:4480144:4490715:1 gene:ENSCPOG00000011944 transcript:ENSCPOT00000012060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPHPDFENVDEDGYTKLNFNTQDATRSPVGSKKGIPAASPAWRLIAVILGILCLIILVI
AVVLGSLDKAFWRSNSGSNLLEKDNSLSRNKEYQNQPTKSSLQENAASTKAFKTTGVFSS
TCPPNWIAHEKSCYLFSISLDSWYGSKRRCSQLGSHLLKIDTLKEFDFIVGQMSSYPNNS
FWIGLSRNQTESLWVWDDGSTFSYNFLQIRSTATQENTPHNCVWLHVGNAYDQPCNILSF
SVCERLLSG
Download sequence
Identical sequences ENSCPOP00000010747 10141.ENSCPOP00000010747 ENSCPOP00000010747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]