SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010974 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010974
Domain Number 1 Region: 59-242
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-19
Family Pentraxin (pentaxin) 0.039
Further Details:      
 
Domain Number 2 Region: 559-828
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000504
Family Rhodopsin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010974   Gene: ENSCPOG00000012201   Transcript: ENSCPOT00000012317
Sequence length 871
Comment pep:known scaffold:cavPor3:scaffold_237:189566:244728:1 gene:ENSCPOG00000012201 transcript:ENSCPOT00000012317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEFSVLASVSHYWPLESVDGIHELQDVAAALRAHNLTVPLPHTSTFVPTRDSAYSNLSAT
VDLMEAKVNKSIYLREEKGVTLLLYNSSSCISSPARCGPTGVTFSFFWKIQGEQSRPAPS
TYGGQVISDGFKVCSSGSRGSVELYTRDDFMTWEAAFSPLGPYWTHVLFTWKSKEGLKVY
VNGTLSTWDSRGRVSRDYGEPSTNLVIGSEQDRTQCYENGAFDEFIFWERALNPAEIRMY
FTAAVGKHGLPSSTPLPSVTMLTAIATVPRDAYHPIIANLTEERKNFSRPHVALSYLRSM
SLSLPNKSLSEETALNLTETFLWTVGEVLLLPGWKAASEDKALVSGLINTIDVVLGHVSL
KLHGRRPEITLEGSSPVADFSVTKLLPRSLSTAYYRFPAHGDSYIEIPGEALRGPAWTTL
VGLSYHSIHNFVSSIPPASTKIPVAASCRDGLLFAVSPLISLEVRPPPALSQNLSRSPLV
TVHLRHTLTQKQHSDATNASNRVFLYCAFLDFSSGKGVWSSQGCALRDGNLTHSTCRCTH
LTNFAILMQVVPLELPYGHQVALSSISYVGCALSVLCLAATLVTFAVLSSVSTIRNQRYH
IHANLSCAVLVAQVLLLGSFHVEPGTVPCQVLATLLHYFFLSAFAWMLVEGLHLYSMVVK
VFGSEGSKRLYYYGIGWGLPLVICVVSISFAMDSYGTSNNCWLSLGTGAIWAFVGPALLV
IVVNIGILIAVTRVISQISADSYKIHGDPSAFKLTVKAVAVLLPILGTSWAFGVLAVNDQ
ALVFQYMFAVLNSLQGGFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARNASGKPFSSDM
MNGTRPGTASTRPSPWDRSSHSAQRVDLSAV
Download sequence
Identical sequences ENSCPOP00000010974 ENSCPOP00000010974 10141.ENSCPOP00000010974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]