SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010990 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010990
Domain Number 1 Region: 513-709
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-47
Family SPRY domain 0.01
Further Details:      
 
Domain Number 2 Region: 448-542
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 233-292
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 3-50
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000013
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010990
Domain Number - Region: 175-209
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0023
Family TFIIH p44 subunit cysteine-rich domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010990   Gene: ENSCPOG00000012219   Transcript: ENSCPOT00000012335
Sequence length 718
Comment pep:known scaffold:cavPor3:scaffold_16:1391765:1423948:1 gene:ENSCPOG00000012219 transcript:ENSCPOT00000012335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAAMEEELKCPVCGALFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLPRGPDS
DPVASGADKLSLHSETDSGYGSYTPSLKSPNGVRVLPTVPAPPGSSAAAARGAACSSLAA
CSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRFQQGRGAAPGASAAAAVAVCQLC
DRTPPEPAAALCEQCDVLYCAACQLKCHPSRGPFAKHRLVQPSPGGASGGAARKFPTCPE
HELENYSMYCASCRSPVCYVCLEDGRHAQHEVKPLGAAWKQHKAQLSQALNGVSDKAKEA
KEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWD
QINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSA
EFDLTLDSEPLLQAIHQLDFLQMKCRVPVPPAPLLQLEKCCTRNNSVTLAWRTPPFTPSP
ADGYVLELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQ
TSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNH
PDPAFGVARASVAKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLL
DLNKRTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTSLGRPKLT
Download sequence
Identical sequences ENSCPOP00000010990 10141.ENSCPOP00000010990 ENSCPOP00000010990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]