SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011165 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011165
Domain Number 1 Region: 22-160
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-33
Family C-type lectin domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 247-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 307-381
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000862
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 371-443
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000249
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 180-240
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 6 Region: 490-551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011165
Domain Number - Region: 146-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011165   Gene: ENSCPOG00000012409   Transcript: ENSCPOT00000012527
Sequence length 614
Comment pep:novel scaffold:cavPor3:scaffold_39:6742133:6751435:-1 gene:ENSCPOG00000012409 transcript:ENSCPOT00000012527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAPQFVSALIFVLLIRDSRSWSYNVSTEPMTYEEARAFCQQRYTHLVAIQNKEEIEYLN
SRLSYSKSYYWIGIRKINNVWIWEGTQKPLTDETENWAPGEPNNKQQDEDCVEIYIRRDK
DAGMWNDEPCSKKKLALCYTAACTNESCSGHGECEETIENHSCKCHPGFRGLRCEQVVTC
KAQENPEHGSLVCTQPFGPFSYNSSCSVSCESGYLPSSNQTPRCLSSGEWSGPMPLCEGV
ISTLAECDALTNPANGSMHCFPNPGRFLWNTTCAFECEEGFELMGAEKLQCTSSGIWDNE
KPTCKAVTCDAIHRLQNGSVNCTHSSAEEFAFRSSCNFNCEEGFTLQGPIQIECTAQGQW
TQQTPVCEALQCRALSTPEQGDMNCFPSALEGFQSGSSCEFSCKQGFVLKGPRRLQCDPT
GVWDQEKPTCEAVTCDAVLRPPNSILECTHLRTHLSTGKFTYKFSCAFHYKEGFDRYTSQ
RQYTQAVFSCQAVHCSRLKVLQTINMNCSGQPVFGTVCNFTCPEGWTLNGSVALTCGTTG
QWSAALPTCEAPVVSSSPLAVGLPVAGTSFLVLGSFLFWLLKLFRKKGHEFVPHKQCFKL
GEDLGWSSPMEYIF
Download sequence
Identical sequences 10141.ENSCPOP00000011165 ENSCPOP00000011165 ENSCPOP00000011165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]