SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011361 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011361
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-39
Family Laminin G-like module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011361
Domain Number - Region: 1469-1520
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00351
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011361   Gene: ENSCPOG00000012629   Transcript: ENSCPOT00000012750
Sequence length 1649
Comment pep:novel scaffold:cavPor3:scaffold_2:27872360:28049219:-1 gene:ENSCPOG00000012629 transcript:ENSCPOT00000012750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCRECGLPLKVVPLIIFGLMSHSVGAGTAPVDVLKALDFHSSPEGISKTTGFCTNRKNSK
GSDTAYRVSKLAQLSAPTKQLFPGGSFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQVG
VEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTK
PLDRSERSIVDTNGITVFGTRILDEEVFEGDIQQFLISADPKAAYDYCEHYSPDCDSSAS
TAAQAQEPQIDEMFPRRGDPKIVEYLTGEDYDPQRKNPEDTLYEKHFDCFCFFTQQINSH
GTYGEKGQKGEPAVVEPGMLVEGPPGPAGPAGLMGPPGSQGPSGPPGDPGDRGPPGRPGL
PGADGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGR
PGPVGGPGSAGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGD
RGFDGLPGLPGDKGHRGERGSQGPPGSPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGT
PGPPGQPGIAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGK
PGLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPVGYPGPRGVKGADGVRGLKGSKGE
KGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPAGQAGEKGKLGV
PGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGK
PGPKGTSGGDGPPGPPGERVSIIQSPNVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGK
TGPPGPGGVVGPQGPTGETGPIGERGREQGLPGAAGKEGAKGDLGPQGIPGKDGPAGLRG
FPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQGPPGPAG
EKGAPPYWGPCFKRYRSHLHYQVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENG
PPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQGLPGPPG
EKGENGDVGPMGPPGPPGPRGPQGPSELMGPQGPPGSVGSVGGVGEKGEPGEAGNPGPPG
EAGTGGPKGERGEKGEAGSPGAAGPPGAKGPPGDDGPKGNPPFKTSFQGPDPDKNEMEKY
GQDGVSGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGSEGRQGEKGAKGEAGAE
GPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPIGPPGLPGLKGDP
GSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGTPGPAGPIGPPGAPGLP
GPQGPKGNKGSSGPAGQKGDKSNQGPPPNQGPPGEVIQPLPILSPKKTRRHAESIQADAG
DNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDP
NQGCSGDSFKVYCNFTSGGETCIYPDKKSEGLSYVDVEGNSINMVQMTFLKLLTASARQN
FTYHCHQSGNYDKALRFLGSNDEEMSYDNNPYIKALYDGCASRKGYDKTVIEINTPKIDQ
VPIIDVMISDFGDQNQKCGFEVGPVCFLG
Download sequence
Identical sequences ENSCPOP00000011361 10141.ENSCPOP00000011361 ENSCPOP00000011361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]