SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011550 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011550
Domain Number 1 Region: 471-628
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.47e-29
Family Growth factor receptor domain 0.00055
Further Details:      
 
Domain Number 2 Region: 613-780
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.75e-28
Family Growth factor receptor domain 0.00022
Further Details:      
 
Domain Number 3 Region: 2529-2652
Classification Level Classification E-value
Superfamily CalX-like 3.4e-25
Family CalX-beta domain 0.00083
Further Details:      
 
Domain Number 4 Region: 918-1059
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.03e-25
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 5 Region: 2899-3028
Classification Level Classification E-value
Superfamily CalX-like 1.11e-23
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 6 Region: 768-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.5e-22
Family Growth factor receptor domain 0.0017
Further Details:      
 
Domain Number 7 Region: 2777-2892
Classification Level Classification E-value
Superfamily CalX-like 3.79e-21
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 8 Region: 3018-3166
Classification Level Classification E-value
Superfamily CalX-like 4.45e-21
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 9 Region: 385-488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.28e-18
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 10 Region: 2652-2777
Classification Level Classification E-value
Superfamily CalX-like 5.89e-18
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 11 Region: 110-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000023
Family VWC domain 0.028
Further Details:      
 
Domain Number 12 Region: 45-118
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000586
Family VWC domain 0.014
Further Details:      
 
Domain Number 13 Region: 184-244
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000816
Family VWC domain 0.06
Further Details:      
 
Domain Number 14 Region: 237-308
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000209
Family VWC domain 0.014
Further Details:      
 
Domain Number 15 Region: 331-385
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000732
Family VWC domain 0.015
Further Details:      
 
Domain Number 16 Region: 3-53
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000178
Family VWC domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011550   Gene: ENSCPOG00000012831   Transcript: ENSCPOT00000012956
Sequence length 3996
Comment pep:novel scaffold:cavPor3:scaffold_5:2374460:2625453:1 gene:ENSCPOG00000012831 transcript:ENSCPOT00000012956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DATIWKPDSCQNCHCHGDIVLCEAVVCRNPQCAFEKGEVLQIAANQCCPECVSRTPGSCY
HQEKIHEHGTEWGSPPCQVCSCAHGEVRCTPRPCPPRSCGQQELEFTPEGSCCPVCVGPG
KPCFHEGRVYQDGEDWQLSRCAKCMCRDGVTQCFAAQCQPLFCNQDEAVVRVPGKCCPQC
SPPSCSAAGHVYQHGEQWHQDSCTTCSCNRGKIRCHKQACPPLRCQKGQSRVRRPMQCCE
ECVSPAGSCSSNGIVHYQHDMWKGSPCEFCMCHRGQVTCQPPGCEEQACRNGEELIHLDG
KCCPECISRNRYCVYERKAEFISSNVSEIKHIPEGEKWEDGPCKVCECQSAQVTCYEPSC
TPCPVSTLALVERGQCCPHCTSVHCHPDCLTCSHSPNHCDLCQDPTKLLENGRCVHSCGL
AFYQAGSLCLACQPQCSTCTNGLECSSCRPPLLMQQGQCVTTCGDGFYQDRNSCAACHVS
CAGCSGPTEKHCRACRDPLKVLRHGSCENSCGDGFYDKQGTCMACDQSCKSCGPNSPRCL
TCIENMVLHNGQCISECPGGYYADATTRCKVCHNSCASCTGPSSSHCTACAHPKVLQQGY
CLSSCGEGFYADHGVCTACHATCQACVGPEPSHCTECKNPEAGLQVGQLLATVPSGECLP
RCRAQFYLESTGLCEACHQSCLGCTGKNSHDCIACQPSHVLLDGQCLSQCPEGYFNQAGS
CTECHPACRQCHGPLESDCTSCHPHVALTSGNCKTSCKAEKFLNLAGYCIDCHPLCQHCT
ANLQDTGSICLRCQNAHHLLLGDHCVPHCPSGYYTERSTCKRCHSSCRTCRAGGPFSCSS
CNTNLVLTHIGTCSASCFPGHYLDDNRACQPCNPRCRSCVSHASCTSCRDPHKVLLFGEC
QYENCAPQYYLNVSTNTCRECDWSCSECSGPLRTDCLQCMDGYVLQDGACQEQCSPAFYR
DLGVCKSCDNHCLQCQDLHQCTHCEEPFLLLGAQCVQECGKGYFPDHAKHKCTVCPQGCL
QCSSRDWCHLCDQGFFLRNGLCVARCVLGFSAHSSNETCAGKTHTPSLHVNGSLTLAIGS
MKPLDFSLLNIQPQDGTVEDLLFHVVSTPTNGRLVLSRNGKEAQLDKAGHFSWKDVSQKK
VRFVHSKEKLRKGYFSLKISDQQFFSEPQLINIQAFSTQAPYVLRNEDLHISHGEQGTIT
TQILDIRDDDNPQDVVVEVLDSPHHGKLFQTLRSPAASISQFRLDELARGLLLYAHDGSD
STADVIVFQASDGHSFRNILFHVAIGSKNDGALQLVANSMVWVPEGGMLQITNRILQAEA
PGASPDDIVYNITEGHPQFGEVVLLVNLPVDSPGDEGQHLPDGRTATPTNSFTQQDVNDG
VVWYRHSGAPAQSDSFRFQVSRTTDTQTHLESHLFNIAILPQTPEAPQFSLATSLHMTAR
EDGLTVIQPHSLSFVNSKRPSGKMVYNITLPLHPNQGKVLEHRDRPLSPIRYFTQEDVNQ
GKIVYRPPSALPHLREITAFSFAGLPESVKFHFTVSDGEHTSPEMTFTIHLLPTVQQPPA
PQVTAPLLEISRGGRASLGLQVVVRDTQAVPGELFFVLRKPPRHGVLLKDAAGSPGPMLA
GDTFTYDDVEKNALQYVHDGSSAQEDSLEISVTDGLTVTVFQVRVEVSLSEDPWPRLAAG
SSLSMTVSSHSTTTITRSHLAYVDDSSPDPEIWIQLSSLPMYGALLRASGSEVEELSEVA
NFTMEDINNKNIRYSAGFETVSHPVTDSFHFSVSDMDHNRLDNQIFTITITPVENPPPVI
GFADLITVDEGGRAPLSFHHFFATDDHDNVQEDAIIKLSALPKYGCIENTGTGDRFGPGT
TSNPEASFPIQDVLENYIYYFQSVHESIEPTHDIFSFYVSDGTSRSEIHSINITIERKND
EPPRMTVRPLGVKLSLAVVISNSSLSLRDLDTPDNELVFVLTKKPDHGHLLQRLTSSDPL
ENGTVLSQGSSFTYQDVLAGLVGYMPGDSGVAVDDFQFSLTDGLHVDTGRMEIYIGLPIS
DSPRLTVNRGLQLSAGSTGSAARITEQHLKAADTSSGPRQVMYVVREDPSAGRLQMVTPD
SLQQISVHGPVRGFTQADISQGHVEYSHRTGEPGGNFAFKFDVVDVEGNRLMDQSFSIDV
LEGKSPPVIITNKGLVLDENSTTLQLSATDQDGEPAELIYRVTRQPQLGHLEHAASPGNL
ERSSATGSHAAPFHITYIYSSRGVWRQSEELFFLLACGLHISLNKHVTFAFLKHNHNIRD
GSLITETRLCAHKTYNSGVQKLNCHAILKXIRSSVTLDREANAITFRVVQPPRHGMIERT
SRGQHTRLATSFTMEDIYQNRVSYSHDGSNSLKDRFTFTVSDGTNPFFIIEEGGKEITTA
APQQFRVDVLPVDDGTPMIVTNLGLQWLEYMDGKATNLITKKELLTMDPDTDDPQLVYEI
TSGPRHGHVENKLQPGRAATSFSQEEVNLGLIRYVLHEEKIHEMMDSFQFVVKDSKPNVV
GDNIFHIQWSLISFKYTSYNVSEKAGSVSVTVQRTGNLNQYAIVLCRTEQGTASSSSGLG
VSAHPGQQDYVEYAGQVQFDEREDTKSCTIVINDDDVFENTESFTVELSMPAYALLGEFT
KAKVIINDTEDEPTLEFDKKTYRVNESAGFLFAPVERKGDSSSTVSAVCYTVPKSAMGSS
LYALESGSDFKSRGMSAESRVILRPGVTRSTCDVMLIDDSEYEEEEEFEIALADASDNAR
IGRVATARVLINGPNDASTVSLGNTAFTVSEDAGTVRIPVIRHGTDLSTFTSVWCATRPS
DPASATPGVDYVPSSRKVEFGPGVTEQYCTLTILDDTQYPVIEGLETFVVFLSSAQGAEL
SKPSQAVIAINDTFQDAVPSMQFAKDLLLMKEKEGVLHVPIIRSGDLSYESSVRCYTQSH
SARVAEDFKERRNADSSRITFLKGEKVKNCTVYVHDDSMFEPEEQFRVHLGHPLGNHWSG
ARVGKNSMATITITNDEDAPTIEFEEAAYQVREPPGPDATAILNIKVIRRGDQNRTSKVR
CSTRDGSAQSGVDYYPKSRVLKFNPVFGKGVDHIYFKVEILSNEDREWHESFSLVLGPDD
PVEAVLGDVTTATVTILDQEATGSLILPAPPIVVTLADYDHVEEVTKEGAKKAPSPGYPL
VCVTPCDPHFPRFAIMKEHCGEAGINQTSVQFSWEVAAPTDGNGARSPFETVTDSTPFTS
VNHMVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNIVTIGTDSAICHTPVVAGTSRGF
QAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPLHNLHFLLSESIYRHQH
VCSNLVTTRDLRGISEAGFLDDVVYDSTALGPGYDRPFQFDPNVRELKTIQLYKHLNLKS
CVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLYVSYIYVTAPRGWASLEH
HTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVIEFKTHAKFRGQFVMEH
HTLPDVKSFILTPDHLGGIEFDLQLLWSAQTFDSPYQLWRATSSYNRKDYSGEYTIYLIP
CTAQPTQRWADPGEKPLACTAHAPERFLIPIAFQQTNRPVPVVYSLNTEFQLYNNEKVFL
MDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLNSAYKLQLEKVYLCTGKDGYVPF
FDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRSQPEVTDKYFHDVPFEAHFASELPDFHV
VSSMPGMDGFTLKVDALYKVEAGHQWYLQVIYIIGPDTISGPRVQRSLTSPLRRYQRDLV
DPSGQLTLDESLIYDNEGDQVKNGTNMKSLNLEMQEPIIAASLSQTGASVGSALAAIMLL
LLIFLVACFITRKCQKQRKKQPREDILEEYPLNTKVDMPKRTTDRVEKNVNRQYCTVRNV
NILSDTEGAYTFKGAKVKKLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences 10141.ENSCPOP00000011550 ENSCPOP00000011550 ENSCPOP00000011550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]