SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011692 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011692
Domain Number 1 Region: 982-1276
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-80
Family Protein kinases, catalytic subunit 0.0000000000813
Further Details:      
 
Domain Number 2 Region: 331-496
Classification Level Classification E-value
Superfamily L domain-like 1.9e-52
Family L domain 0.0000000888
Further Details:      
 
Domain Number 3 Region: 31-189
Classification Level Classification E-value
Superfamily L domain-like 3.4e-44
Family L domain 0.000000113
Further Details:      
 
Domain Number 4 Region: 493-616
Classification Level Classification E-value
Superfamily Fibronectin type III 1.49e-34
Family Fibronectin type III 0.000000163
Further Details:      
 
Domain Number 5 Region: 783-930
Classification Level Classification E-value
Superfamily Fibronectin type III 7.49e-24
Family Fibronectin type III 0.00000295
Further Details:      
 
Domain Number 6 Region: 620-700,794-818
Classification Level Classification E-value
Superfamily Fibronectin type III 9.42e-20
Family Fibronectin type III 0.00000381
Further Details:      
 
Domain Number 7 Region: 194-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000487
Family Growth factor receptor domain 0.000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011692   Gene: ENSCPOG00000012986   Transcript: ENSCPOT00000013112
Sequence length 1368
Comment pep:known scaffold:cavPor3:scaffold_42:14454603:14579448:-1 gene:ENSCPOG00000012986 transcript:ENSCPOT00000013112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGAREAPGAPLLLVAVAALLVGVTGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQI
LLMFKTKPEDFRDLSFPKLVVITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVV
FEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEEC
GDICPGAAKSKTHCPSTVINGQFVERCWTHTHCQKVCPTACKSHGCTAEGLCCHSECLGN
CTEPDDPTKCVACRNFYLDGRCVATCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQGCH
QYVIHNDRCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGQKTIDSVTSAQELRGCTV
INGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEI
GNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERN
DIALKTNGDQASCENELLKFSFIRTSSDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNV
TEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDE
RRTYGAKSDIIYVQTDATNPSVPLDPLSVSNSSSQIILKWKPPSDPNGNITHYLVYWQRQ
AEDSELYELDYCLKGLKLPSRAWSPPLESDDAQKHNQSEYEDAAGECCSCPKTDSQILKE
LEESSFRKTFEDYLHNVVFVPRPSRKRRSLGEVANGTALVPTAPSFPGVSTPSVPGSQEE
PRPFEKVVNKESLVISGLRHFTGYRIELQACNQGAPEERCSVAAYVSARTMPEAKADDIV
GPVAHEIFDNNVVHLMWQEPKEPNGLIVLYEVSYRRYGEEEMHLCVSRKHYALERGCRLR
GLQPGNYSVRIRATSLAGNGSWTEPTYFYVTNYSDVSSNIAKMIIGPLIFVFLFSVVIGS
IYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSF
GMVYEGNAKDIIKGEAETRVAVKTVNEAASLRERIEFLNEASVMKGFTCHHVVRLLGVVS
KGQPTLVVMELMAHGDLKSYLRSLRPESENNPGRPPPTLQEMIQMAAEIADGMAYLNAKK
FVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFT
ASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQ
FNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELELEFEDMENVPLDRSSH
CQREEAGGREGGSSLGIKRTYEEHIPYTHMNGGKKNGRILTLPRSSPS
Download sequence
Identical sequences 10141.ENSCPOP00000011692 ENSCPOP00000011692 ENSCPOP00000011692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]